www.halkivahanmetsastysyhdistys.fi
ELMONET-AS, FI
Seen 2 times between March 12th, 2020 and May 27th, 2023.
General Info Open in Search
Geo | Tampere, Finland (FI) — |
Domain | halkivahanmetsastysyhdistys.fi (The registered domain) |
AS | AS8829 - ELMONET-AS, FI
Note: An IP might be announced by multiple ASs. This is not shown. |
Registrar | RIPENCC |
Route | 109.204.192.0/18 (Route of ASN) |
PTR | tietokettu.net(PTR record of primary IP) |
IPv4 | 109.204.224.162 |
Direct hits
Summary of pages hosted on this domain
IPs 34.253.68.195 | 1x
Domains www.halkivahanmetsastysyhdistys.fi | 1x
Recent scans (1 total) Show all
URL | Age | |||||
---|---|---|---|---|---|---|
www.halkivahanmetsastysyhdistys.fi | 5 years | 36 | 9 | 5 |
Incoming hits
Summary of pages that talked to this domain
ASNs AS29422 | 1x
IPs 77.86.252.86 | 1x
Domains halkivahanmetsastysyhdistys.fi | 1x
Countries FI | 1x
Recent scans (1 total) Show all
URL | Age | |||||
---|---|---|---|---|---|---|
halkivahanmetsastysyhdistys.fi | a year | 27 | 2 | 1 |
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recent screenshots
Screenshots of pages hosted on this domain
Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to
IPs 34.253.68.195 | 1x
Domains www.halkivahanmetsastysyhdistys.fi | 1x
Recently observed hostnames on 'www.halkivahanmetsastysyhdistys.fi'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
www.halkivahanmetsastysyhdistys.fi
| 2017-05-31
Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.
WHOIS for www.halkivahanmetsastysyhdistys.fi
domain.............: halkivahanmetsastysyhdistys.fi status.............: Registered created............: 15.8.2014 19:42:59 expires............: 15.8.2025 19:42:59 available..........: 15.9.2025 19:42:59 modified...........: 21.7.2024 20:32:58 RegistryLock.......: no Nameservers nserver............: ns2.tietokettu.net [Technical Error] nserver............: ns1.tietokettu.net [Technical Error] DNSSEC dnssec.............: no Holder name...............: Halkivahan Mets�stysyhdistys ry register number....: 0305646-4 address............: Niitoksentie 53C postal.............: 31730 city...............: Honkola country............: Finland phone..............: holder email.......: Registrar registrar..........: HD-decor Oy www................: https://tietokettu.net >>> Last update of WHOIS database: 27.9.2024 7:01:08 (EET) <<< Copyright (c) Finnish Transport and Communications Agency Traficom