www.ravinderreddywedskeerthireddy.appvideo.viewliveevents.net


Seen 1 times between April 1st, 2024 and April 1st, 2024.


General Info Open in Search

Created May 4th, 2012
Domain viewliveevents.net (The registered domain)

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

No direct hits
Nothing is hosted on this domain

Incoming hits
Summary of pages that talked to this domain

ASNs AS26666 | 1x

IPs 216.219.95.231 | 1x

Domains ravinderreddywedskeerthireddy.appvideo.viewliveevents.net | 1x

Countries US | 1x

Recent scans (1 total) Show all

URL Age
ravinderreddywedskeerthireddy.appvideo.viewliveevents.net 6 months

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recently observed hostnames on 'www.ravinderreddywedskeerthireddy.appvideo.viewliveevents.net'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

www.ravinderreddywedskeerthireddy.appvideo.viewliveevents.net | 2024-03-31

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

Related screenshots
Screenshots of pages that talked to this domain

WHOIS for www.ravinderreddywedskeerthireddy.appvideo.viewliveevents.net

Domain Name: VIEWLIVEEVENTS.NET
Registry Domain ID: 1718008443_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 2023-09-05T11:15:53Z
Creation Date: 2012-05-04T12:29:04Z
Registrar Registration Expiration Date: 2025-05-04T12:29:04Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Cybermedha Domains
Registrant Organization: Cybermedha Solutions
Registrant Street: SR Nagar   
Registrant City: Hyderabad
Registrant State/Province: Telangana
Registrant Postal Code: 500038
Registrant Country: IN
Registrant Phone: +91.8143220264
Registrant Phone Ext: 
Registrant Fax: 
Registrant Fax Ext: 
Registrant Email: cybermedha@outlook.com
Registry Admin ID: Not Available From Registry
Admin Name: Cybermedha Domains
Admin Organization: Cybermedha Solutions
Admin Street: SR Nagar  
Admin City: Hyderabad
Admin State/Province: Telangana
Admin Postal Code: 500038
Admin Country: IN
Admin Phone: +91.8143220264
Admin Phone Ext: 
Admin Fax: 
Admin Fax Ext: 
Admin Email: cybermedha@outlook.com
Registry Tech ID: Not Available From Registry
Tech Name: Cybermedha Domains
Tech Organization: Cybermedha Solutions
Tech Street: SR Nagar  
Tech City: Hyderabad
Tech State/Province: Telangana
Tech Postal Code: 500038
Tech Country: IN
Tech Phone: +91.8143220264
Tech Phone Ext: 
Tech Fax: 
Tech Fax Ext: 
Tech Email: cybermedha@outlook.com
Name Server: dns1.viewliveevents.com
Name Server: dns2.viewliveevents.com
Name Server: dns3.viewliveevents.com
Name Server: dns4.viewliveevents.com
Name Server: dns5.viewliveevents.com
Name Server: dns6.viewliveevents.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
Registrar Abuse Contact Phone: +1.2013775952
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2024-10-01T08:51:56Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Registration Service Provided By: CYBERMEDHA SOLUTIONS PVT. LTD.

The data in this whois database is provided to you for information purposes 
only, that is, to assist you in obtaining information about or related to a 
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree 
that you will use this data only for lawful purposes and that, under no 
circumstances will you use this data to: 
(1) enable high volume, automated, electronic processes that stress or load 
this whois database system providing you this information; or 
(2) allow, enable, or otherwise support the transmission of mass unsolicited, 
commercial advertising or solicitations via direct mail, electronic mail, or 
by telephone. 
The compilation, repackaging, dissemination or other use of this data is 
expressly prohibited without prior written consent from us. The Registrar of 
record is PDR Ltd. d/b/a PublicDomainRegistry.com. 
We reserve the right to modify these terms at any time. 
By submitting this query, you agree to abide by these terms.