www.ravinderreddywedskeerthireddy.appvideo.viewliveevents.net
Seen 1 times between April 1st, 2024 and April 1st, 2024.
General Info Open in Search
Created | May 4th, 2012 |
Domain | viewliveevents.net (The registered domain) |
No direct hits
Nothing is hosted on this domain
Incoming hits
Summary of pages that talked to this domain
ASNs AS26666 | 1x
IPs 216.219.95.231 | 1x
Domains ravinderreddywedskeerthireddy.appvideo.viewliveevents.net | 1x
Countries US | 1x
Recent scans (1 total) Show all
URL | Age | |||||
---|---|---|---|---|---|---|
ravinderreddywedskeerthireddy.appvideo.viewliveevents.net | 6 months | 86 | 41 | 4 |
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recently observed hostnames on 'www.ravinderreddywedskeerthireddy.appvideo.viewliveevents.net'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
www.ravinderreddywedskeerthireddy.appvideo.viewliveevents.net
| 2024-03-31
Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.
WHOIS for www.ravinderreddywedskeerthireddy.appvideo.viewliveevents.net
Domain Name: VIEWLIVEEVENTS.NET Registry Domain ID: 1718008443_DOMAIN_NET-VRSN Registrar WHOIS Server: whois.publicdomainregistry.com Registrar URL: www.publicdomainregistry.com Updated Date: 2023-09-05T11:15:53Z Creation Date: 2012-05-04T12:29:04Z Registrar Registration Expiration Date: 2025-05-04T12:29:04Z Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com Registrar IANA ID: 303 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Cybermedha Domains Registrant Organization: Cybermedha Solutions Registrant Street: SR Nagar Registrant City: Hyderabad Registrant State/Province: Telangana Registrant Postal Code: 500038 Registrant Country: IN Registrant Phone: +91.8143220264 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: cybermedha@outlook.com Registry Admin ID: Not Available From Registry Admin Name: Cybermedha Domains Admin Organization: Cybermedha Solutions Admin Street: SR Nagar Admin City: Hyderabad Admin State/Province: Telangana Admin Postal Code: 500038 Admin Country: IN Admin Phone: +91.8143220264 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: cybermedha@outlook.com Registry Tech ID: Not Available From Registry Tech Name: Cybermedha Domains Tech Organization: Cybermedha Solutions Tech Street: SR Nagar Tech City: Hyderabad Tech State/Province: Telangana Tech Postal Code: 500038 Tech Country: IN Tech Phone: +91.8143220264 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: cybermedha@outlook.com Name Server: dns1.viewliveevents.com Name Server: dns2.viewliveevents.com Name Server: dns3.viewliveevents.com Name Server: dns4.viewliveevents.com Name Server: dns5.viewliveevents.com Name Server: dns6.viewliveevents.com DNSSEC: Unsigned Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com Registrar Abuse Contact Phone: +1.2013775952 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2024-10-01T08:51:56Z <<< For more information on Whois status codes, please visit https://icann.org/epp Registration Service Provided By: CYBERMEDHA SOLUTIONS PVT. LTD. The data in this whois database is provided to you for information purposes only, that is, to assist you in obtaining information about or related to a domain name registration record. We make this information available "as is", and do not guarantee its accuracy. By submitting a whois query, you agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (1) enable high volume, automated, electronic processes that stress or load this whois database system providing you this information; or (2) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via direct mail, electronic mail, or by telephone. The compilation, repackaging, dissemination or other use of this data is expressly prohibited without prior written consent from us. The Registrar of record is PDR Ltd. d/b/a PublicDomainRegistry.com. We reserve the right to modify these terms at any time. By submitting this query, you agree to abide by these terms.