escortserviceindwarkacallgirlpalam.blogspot.in
GOOGLE, US
Not observed on urlscan.io
General Info Open in Search
Geo | United States (US) — |
AS | AS15169 - GOOGLE, US
Note: An IP might be announced by multiple ASs. This is not shown. |
Registrar | ARIN |
Route | 142.250.185.0/24 (Route of ASN) |
PTR | fra16s50-in-f1.1e100.net(PTR record of primary IP) |
IPv4 | 142.250.185.129 |
IPv6 | 2a00:1450:4001:810::2001 |
No direct hits
Nothing is hosted on this domain
No incoming hits
Nothing talked to this domain
Recently observed hostnames on 'escortserviceindwarkacallgirlpalam.blogspot.in'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
escortserviceindwarkacallgirlpalam.blogspot.in
| 2020-07-28
WHOIS for escortserviceindwarkacallgirlpalam.blogspot.in
No Data Found >>> Last update of WHOIS database: 2024-05-16T11:42:28Z <<< For more information on Whois status codes, please visit https://icann.org/epp Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only ,and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator or a Registrar, or NIXI except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.