drippingspringsfamilysmilesfamily.wordpress.com
AUTOMATTIC, US


Not observed on urlscan.io


General Info Open in Search

Geo San Francisco, California, United States (US) —
Created March 3rd, 2000
Domain wordpress.com (The registered domain)
AS AS2635 - AUTOMATTIC, US
Note: An IP might be announced by multiple ASs. This is not shown.
Registrar ARIN
Route 192.0.78.0/24 (Route of ASN)
IPv4 192.0.78.13  192.0.78.12 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

No direct hits
Nothing is hosted on this domain

No incoming hits
Nothing talked to this domain

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

DNS recordsRetrieved via DNS ANY query

CNAME lb.wordpress.com

Registration information

Created March 3rd, 2000
Updated August 2nd, 2024
Registrar MarkMonitor, Inc.

WHOIS for drippingspringsfamilysmilesfamily.wordpress.com

Domain Name: wordpress.com
Registry Domain ID: 21242797_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.markmonitor.com
Registrar URL: http://www.markmonitor.com
Updated Date: 2024-08-02T02:17:33+0000
Creation Date: 2000-03-03T12:13:23+0000
Registrar Registration Expiration Date: 2033-03-03T00:00:00+0000
Registrar: MarkMonitor, Inc.
Registrar IANA ID: 292
Registrar Abuse Contact Email: abusecomplaints@markmonitor.com
Registrar Abuse Contact Phone: +1.2086851750
Domain Status: clientUpdateProhibited (https://www.icann.org/epp#clientUpdateProhibited)
Domain Status: clientTransferProhibited (https://www.icann.org/epp#clientTransferProhibited)
Domain Status: clientDeleteProhibited (https://www.icann.org/epp#clientDeleteProhibited)
Domain Status: serverUpdateProhibited (https://www.icann.org/epp#serverUpdateProhibited)
Domain Status: serverTransferProhibited (https://www.icann.org/epp#serverTransferProhibited)
Domain Status: serverDeleteProhibited (https://www.icann.org/epp#serverDeleteProhibited)
Registrant Organization: Automattic, Inc.
Registrant State/Province: CA
Registrant Country: US
Registrant Email: Select Request Email Form at https://domains.markmonitor.com/whois/wordpress.com
Admin Organization: Automattic, Inc.
Admin State/Province: CA
Admin Country: US
Admin Email: Select Request Email Form at https://domains.markmonitor.com/whois/wordpress.com
Tech Organization: Automattic, Inc.
Tech State/Province: CA
Tech Country: US
Tech Email: Select Request Email Form at https://domains.markmonitor.com/whois/wordpress.com
Name Server: ns1.wordpress.com
Name Server: ns3.wordpress.com
Name Server: ns2.wordpress.com
Name Server: ns4.wordpress.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2024-10-14T03:02:18+0000 <<<

For more information on WHOIS status codes, please visit:
  https://www.icann.org/resources/pages/epp-status-codes

If you wish to contact this domain’s Registrant, Administrative, or Technical
contact, and such email address is not visible above, you may do so via our web
form, pursuant to ICANN’s Temporary Specification. To verify that you are not a
robot, please enter your email address to receive a link to a page that
facilitates email communication with the relevant contact(s).

Web-based WHOIS:
  https://domains.markmonitor.com/whois

If you have a legitimate interest in viewing the non-public WHOIS details, send
your request and the reasons for your request to whoisrequest@markmonitor.com
and specify the domain name in the subject line. We will review that request and
may ask for supporting documentation and explanation.

The data in MarkMonitor’s WHOIS database is provided for information purposes,
and to assist persons in obtaining information about or related to a domain
name’s registration record. While MarkMonitor believes the data to be accurate,
the data is provided "as is" with no guarantee or warranties regarding its
accuracy.

By submitting a WHOIS query, you agree that you will use this data only for
lawful purposes and that, under no circumstances will you use this data to:
  (1) allow, enable, or otherwise support the transmission by email, telephone,
or facsimile of mass, unsolicited, commercial advertising, or spam; or
  (2) enable high volume, automated, or electronic processes that send queries,
data, or email to MarkMonitor (or its systems) or the domain name contacts (or
its systems).

MarkMonitor reserves the right to modify these terms at any time.

By submitting this query, you agree to abide by this policy.

MarkMonitor Domain Management(TM)
Protecting companies and consumers in a digital world.

Visit MarkMonitor at https://www.markmonitor.com
Contact us at +1.8007459229
In Europe, at +44.02032062220
--