Submitted URL: https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ruidm=1&du=//sync.adkernel.com/user-sync?zone=181225&dsp=629319&t=iframe...
Effective URL: https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ct=1&ruidm=1&du=//sync.adkernel.com/user-sync?zone=181225&dsp=629319&t=i...
Submission: On February 21 via api from GB — Scanned from US

Summary

This website contacted 53 IPs in 7 countries across 89 domains to perform 273 HTTP transactions. The main IP is 172.98.26.246, located in Ashburn, United States and belongs to E-PLANNING-, US. The main domain is ads.us.e-planning.net. The Cisco Umbrella rank of the primary domain is 2336.
TLS certificate: Issued by R3 on February 6th 2024. Valid for: 3 months.
This is the only time ads.us.e-planning.net was scanned on urlscan.io!

urlscan.io Verdict: No classification

Domain & IP information

IP Address AS Autonomous System
1 42 172.98.26.246 399668 (E-PLANNING-)
5 5 207.198.113.89 13768 (COGECO-PEER1)
2 4 3.212.118.216 14618 (AMAZON-AES)
6 9 34.111.113.62 396982 (GOOGLE-CL...)
6 6 198.148.27.131 19189 (PULSEPOINT)
2 8.2.110.17 46636 (NATCOWEB)
4 172.98.26.242 399668 (E-PLANNING-)
3 3 35.227.252.103 396982 (GOOGLE-CL...)
16 16 205.180.85.169 25751 (VALUECLICK)
4 4 162.55.233.29 24940 (HETZNER-AS)
15 17 68.67.160.75 29990 (ASN-APPNEX)
2 2 69.166.1.66 27630 (AS-XFERNET)
2 2 138.197.58.184 14061 (DIGITALOC...)
2 3 3.212.214.228 14618 (AMAZON-AES)
2 2 54.235.132.105 14618 (AMAZON-AES)
2 172.240.155.108 7979 (SERVERS-COM)
2 2 8.2.110.161 46636 (NATCOWEB)
2 2 47.253.61.56 45102 (ALIBABA-C...)
10 10 69.194.240.13 26120 (RHYTHMONE)
3 3 50.116.194.21 6336 (TURN-US-ASN)
4 4 23.1.200.83 16625 (AKAMAI-AS)
8 23.52.161.107 16625 (AKAMAI-AS)
3 23.56.163.14 16625 (AKAMAI-AS)
3 12 104.18.36.155 13335 (CLOUDFLAR...)
2 2 34.201.202.246 14618 (AMAZON-AES)
4 74.119.119.150 ()
2 9 52.46.130.91 16509 (AMAZON-02)
11 23 142.251.35.162 15169 (GOOGLE)
15 15 3.33.220.150 16509 (AMAZON-02)
3 3 34.170.123.2 396982 (GOOGLE-CL...)
5 5 216.200.232.249 30419 (MEDIAMATH...)
2 2 199.38.167.130 54312 (ROCKETFUEL)
2 12 104.22.17.141 13335 (CLOUDFLAR...)
6 39 51.222.39.185 16276 (OVH)
2 108.138.128.46 16509 (AMAZON-02)
2 23.22.54.252 14618 (AMAZON-AES)
6 19 35.71.139.29 16509 (AMAZON-02)
8 174.137.133.32 27257 (WEBAIR-IN...)
3 8.28.7.81 62713 (AS-PUBMATIC)
5 5 35.207.24.140 15169 (GOOGLE)
3 213.19.162.90 26667 (RUBICONPR...)
3 4 63.251.28.233 13789 (INTERNAP-...)
9 15 8.43.72.98 26667 (RUBICONPR...)
3 3 80.77.87.162 46636 (NATCOWEB)
4 4 82.145.213.8 39832 (NO-OPERA)
3 216.22.16.53 30633 (LEASEWEB-...)
3 8.28.7.82 62713 (AS-PUBMATIC)
4 7 3.225.218.10 14618 (AMAZON-AES)
7 11 35.211.178.172 19527 (GOOGLE-2)
3 4 147.75.195.77 54825 (PACKET)
1 1 138.199.41.120 60068 (CDN77 _)
1 37.157.4.29 ()
5 9 8.43.72.97 26667 (RUBICONPR...)
2 2 35.211.233.246 19527 (GOOGLE-2)
3 5 54.152.27.42 14618 (AMAZON-AES)
1 1 34.96.71.22 396982 (GOOGLE-CL...)
1 2 54.148.134.78 16509 (AMAZON-02)
2 172.64.146.152 13335 (CLOUDFLAR...)
1 23.51.57.155 16625 (AKAMAI-AS)
2 3 216.22.16.72 30633 (LEASEWEB-...)
2 104.22.16.141 13335 (CLOUDFLAR...)
4 13.107.42.14 8068 (MICROSOFT...)
2 3 52.201.172.17 14618 (AMAZON-AES)
8 8 52.71.89.83 14618 (AMAZON-AES)
1 1 108.139.47.128 16509 (AMAZON-02)
1 1 18.164.96.92 16509 (AMAZON-02)
1 18.173.219.124 16509 (AMAZON-02)
1 2 174.129.113.54 14618 (AMAZON-AES)
1 104.117.182.185 20940 (AKAMAI-ASN1)
1 1 35.211.118.13 15169 (GOOGLE)
2 12 8.28.7.83 62713 (AS-PUBMATIC)
2 2 150.136.156.92 31898 (ORACLE-BM...)
8 162.248.18.37 62713 (AS-PUBMATIC)
1 2 151.101.130.49 54113 (FASTLY)
1 1 192.184.68.149 14618 (AMAZON-AES)
1 1 44.195.52.34 14618 (AMAZON-AES)
3 8.28.7.84 62713 (AS-PUBMATIC)
1 2 165.254.203.172 2914 (NTT-LTD-2914)
1 35.186.193.173 15169 (GOOGLE)
1 23.88.86.2 24940 (HETZNER-AS)
1 195.5.165.20 44968 (IPROM-AS)
2 2 23.1.193.230 16625 (AKAMAI-AS)
1 50.19.17.70 14618 (AMAZON-AES)
1 1 188.166.17.21 14061 (DIGITALOC...)
1 18.238.55.69 16509 (AMAZON-02)
2 2 35.244.154.8 15169 (GOOGLE)
1 1 107.178.254.65 15169 (GOOGLE)
273 53
Apex Domain
Subdomains
Transfer
46 e-planning.net
ads.us.e-planning.net — Cisco Umbrella Rank: 2336
sync.e-planning.net — Cisco Umbrella Rank: 3853
u-iad04.e-planning.net — Cisco Umbrella Rank: 4999
s.e-planning.net — Cisco Umbrella Rank: 5248
12 KB
39 onetag-sys.com
onetag-sys.com — Cisco Umbrella Rank: 711
19 KB
39 rubiconproject.com
secure-assets.rubiconproject.com — Cisco Umbrella Rank: 1120
eus.rubiconproject.com — Cisco Umbrella Rank: 626
pixel-eu.rubiconproject.com — Cisco Umbrella Rank: 2095
pixel.rubiconproject.com — Cisco Umbrella Rank: 413
token.rubiconproject.com — Cisco Umbrella Rank: 499
pixel-us-east.rubiconproject.com — Cisco Umbrella Rank: 1347
66 KB
32 pubmatic.com
ads.pubmatic.com — Cisco Umbrella Rank: 555
image6.pubmatic.com — Cisco Umbrella Rank: 976
image8.pubmatic.com — Cisco Umbrella Rank: 676
simage2.pubmatic.com — Cisco Umbrella Rank: 1075
image2.pubmatic.com — Cisco Umbrella Rank: 1105
image4.pubmatic.com — Cisco Umbrella Rank: 1314
simage4.pubmatic.com — Cisco Umbrella Rank: 1383
43 KB
23 doubleclick.net
cm.g.doubleclick.net — Cisco Umbrella Rank: 278
3 KB
19 3lift.com
eb2.3lift.com — Cisco Umbrella Rank: 458
10 KB
17 adnxs.com
ib.adnxs.com — Cisco Umbrella Rank: 272
secure.adnxs.com — Cisco Umbrella Rank: 523
18 KB
16 dotomi.com
prebid-match.dotomi.com — Cisco Umbrella Rank: 2017
casale-match.dotomi.com — Cisco Umbrella Rank: 3673
retargetly-match.dotomi.com — Cisco Umbrella Rank: 13050
pubmatic-match.dotomi.com — Cisco Umbrella Rank: 4047
5 KB
15 adsrvr.org
match.adsrvr.org — Cisco Umbrella Rank: 389
6 KB
14 retargetly.com
api.retargetly.com — Cisco Umbrella Rank: 5374
pdp-cdn.retargetly.com — Cisco Umbrella Rank: 8770
pdp-service.retargetly.com — Cisco Umbrella Rank: 8286
app.retargetly.com — Cisco Umbrella Rank: 11729
17 KB
12 bidswitch.net
x.bidswitch.net — Cisco Umbrella Rank: 396
r.bidswitch.net — Cisco Umbrella Rank: 8458
4 KB
12 yahoo.com
ups.analytics.yahoo.com — Cisco Umbrella Rank: 421
pr-bh.ybp.yahoo.com — Cisco Umbrella Rank: 519
cms.analytics.yahoo.com — Cisco Umbrella Rank: 1552
4 KB
12 casalemedia.com
ssum.casalemedia.com — Cisco Umbrella Rank: 1349
dsum-sec.casalemedia.com — Cisco Umbrella Rank: 696
dsum.casalemedia.com — Cisco Umbrella Rank: 1560
ssum-sec.casalemedia.com — Cisco Umbrella Rank: 541
9 KB
9 amazon-adsystem.com
s.amazon-adsystem.com — Cisco Umbrella Rank: 311
aax-eu.amazon-adsystem.com Failed
6 KB
9 tapad.com
pixel.tapad.com — Cisco Umbrella Rank: 543
3 KB
8 bidr.io
match.prod.bidr.io — Cisco Umbrella Rank: 613
5 KB
8 adkernel.com
sync.adkernel.com — Cisco Umbrella Rank: 1764
5 KB
7 1rx.io
sync.1rx.io — Cisco Umbrella Rank: 584
4 KB
6 smartadserver.com
ssbsync-global.smartadserver.com — Cisco Umbrella Rank: 1756
sync.smartadserver.com — Cisco Umbrella Rank: 1438
rtb-csync.smartadserver.com — Cisco Umbrella Rank: 685
2 KB
6 contextweb.com
bh.contextweb.com — Cisco Umbrella Rank: 585
4 KB
6 crwdcntrl.net
sync.crwdcntrl.net — Cisco Umbrella Rank: 1012
tags.crwdcntrl.net — Cisco Umbrella Rank: 1113
bcp.crwdcntrl.net — Cisco Umbrella Rank: 1084
38 KB
5 mfadsrvr.com
rtb.mfadsrvr.com — Cisco Umbrella Rank: 1198
2 KB
5 mathtag.com
sync.mathtag.com — Cisco Umbrella Rank: 1265
3 KB
5 admanmedia.com
sync.admanmedia.com — Cisco Umbrella Rank: 2887
cs.admanmedia.com — Cisco Umbrella Rank: 1166
2 KB
5 sitescout.com
pixel-sync.sitescout.com — Cisco Umbrella Rank: 744
3 KB
4 linkedin.com
px.ads.linkedin.com — Cisco Umbrella Rank: 391
2 KB
4 a-mo.net
prebid.a-mo.net — Cisco Umbrella Rank: 854
2 KB
4 opera.com
t.adx.opera.com — Cisco Umbrella Rank: 1264
2 KB
4 stickyadstv.com
ads.stickyadstv.com — Cisco Umbrella Rank: 619
2 KB
4 criteo.com
dis.criteo.com
1 KB
4 richaudience.com
sync.richaudience.com — Cisco Umbrella Rank: 1846
1 KB
3 cognitivlabs.com
beacon.lynx.cognitivlabs.com — Cisco Umbrella Rank: 1794
1 KB
3 simpli.fi
um.simpli.fi — Cisco Umbrella Rank: 964
2 KB
3 unrulymedia.com
sync.targeting.unrulymedia.com — Cisco Umbrella Rank: 1299
1 KB
3 turn.com
ad.turn.com — Cisco Umbrella Rank: 1011
1 KB
3 sharethrough.com
match.sharethrough.com — Cisco Umbrella Rank: 537
764 B
3 openx.net
rtb.openx.net — Cisco Umbrella Rank: 670
us-u.openx.net Failed
553 B
2 rlcdn.com
idsync.rlcdn.com — Cisco Umbrella Rank: 493
838 B
2 owneriq.net
px.owneriq.net — Cisco Umbrella Rank: 2106
1 KB
2 mxptint.net
pmp.mxptint.net — Cisco Umbrella Rank: 6122
967 B
2 everesttech.net
sync-tm.everesttech.net — Cisco Umbrella Rank: 810
772 B
2 technoratimedia.com
sync.technoratimedia.com — Cisco Umbrella Rank: 2229
2 KB
2 lijit.com
ce.lijit.com — Cisco Umbrella Rank: 1053
837 B
2 intentiq.com
sync.intentiq.com — Cisco Umbrella Rank: 1059
sync1.intentiq.com — Cisco Umbrella Rank: 2949
2 KB
2 connatix.com
capi.connatix.com — Cisco Umbrella Rank: 1013
164 B
2 demdex.net
dpm.demdex.net — Cisco Umbrella Rank: 250
1 KB
2 sportradarserving.com
a.sportradarserving.com — Cisco Umbrella Rank: 2604
963 B
2 gumgum.com
rtb.gumgum.com — Cisco Umbrella Rank: 1576
421 B
2 rfihub.com
p.rfihub.com — Cisco Umbrella Rank: 1003
2 KB
2 liadm.com
i.liadm.com — Cisco Umbrella Rank: 607
1 KB
2 ymmobi.com
gw-iad-bid.ymmobi.com — Cisco Umbrella Rank: 3751
705 B
2 mgid.com
cm-x.mgid.com — Cisco Umbrella Rank: 3778
1 KB
2 colossusssp.com
sync.colossusssp.com — Cisco Umbrella Rank: 1603
404 B
2 nextmillmedia.com
cookies.nextmillmedia.com — Cisco Umbrella Rank: 2481
407 B
2 om-meta.com
rtb.om-meta.com — Cisco Umbrella Rank: 4576
569 B
2 sonobi.com
sync.go.sonobi.com — Cisco Umbrella Rank: 1137
1 KB
1 pippio.com
pippio.com — Cisco Umbrella Rank: 958
633 B
1 adswizz.com
synchroscript.deliveryengine.adswizz.com — Cisco Umbrella Rank: 3177
202 B
1 bidtheatre.com
match.adsby.bidtheatre.com — Cisco Umbrella Rank: 2836
555 B
1 kargo.com
crb.kargo.com — Cisco Umbrella Rank: 1223
359 B
1 iprom.net
core.iprom.net — Cisco Umbrella Rank: 6798
282 B
1 truffle.bid
matching.truffle.bid — Cisco Umbrella Rank: 7636
1 ctnsnet.com
ipac.ctnsnet.com — Cisco Umbrella Rank: 6473
360 B
1 adstanding.com
rtb.adstanding.com — Cisco Umbrella Rank: 9027
358 B
1 quantserve.com
cms.quantserve.com — Cisco Umbrella Rank: 928
594 B
1 yahoo.net
hb.yahoo.net — Cisco Umbrella Rank: 734
564 B
1 primis.tech
live.primis.tech — Cisco Umbrella Rank: 1676
557 B
1 teads.tv
sync.teads.tv — Cisco Umbrella Rank: 1531
153 B
1 company-target.com
s.company-target.com — Cisco Umbrella Rank: 1329
424 B
1 adform.net
cm.adform.net
c1.adform.net Failed
106 B
1 a-mx.com
id.a-mx.com — Cisco Umbrella Rank: 1977
687 B
0 bfmio.com Failed
sync.bfmio.com Failed
0 thrtle.com Failed
thrtle.com Failed
0 appier.net Failed
gocm.c.appier.net Failed
0 mrtnsvr.com Failed
ad.mrtnsvr.com Failed
0 adentifi.com Failed
rtb.adentifi.com Failed
0 ipredictive.com Failed
sync.ipredictive.com Failed
0 antigena.com Failed
us01.z.antigena.com Failed
0 acuityplatform.com Failed
ums.acuityplatform.com Failed
0 loopme.me Failed
csync.loopme.me Failed
0 stackadapt.com Failed
sync.srv.stackadapt.com Failed
0 tribalfusion.com Failed
a.tribalfusion.com Failed
0 w55c.net Failed
pm.w55c.net Failed
0 deepintent.com Failed
match.deepintent.com Failed
0 idsyncmxedge.com Failed
idsyncmxedge.com Failed
serverf5.idsyncmxedge.com Failed
0 creativecdn.com Failed
creativecdn.com Failed
0 zemanta.com Failed
b1sync.zemanta.com Failed
0 ib-ibi.com Failed
global.ib-ibi.com Failed
0 eexsync.com Failed
eexsync.com Failed
273 89
Domain Requested by
39 onetag-sys.com 6 redirects ads.us.e-planning.net
onetag-sys.com
sync.adkernel.com
27 u-iad04.e-planning.net ads.us.e-planning.net
ssum.casalemedia.com
ads.pubmatic.com
sync.adkernel.com
23 cm.g.doubleclick.net 11 redirects ssum.casalemedia.com
onetag-sys.com
eb2.3lift.com
ads.us.e-planning.net
19 eb2.3lift.com 6 redirects ads.us.e-planning.net
eb2.3lift.com
ads.pubmatic.com
15 match.adsrvr.org 15 redirects
15 ib.adnxs.com 13 redirects eb2.3lift.com
13 pixel.rubiconproject.com 7 redirects onetag-sys.com
ads.us.e-planning.net
12 simage2.pubmatic.com 2 redirects ads.pubmatic.com
12 sync.e-planning.net ads.us.e-planning.net
onetag-sys.com
eb2.3lift.com
11 x.bidswitch.net 7 redirects onetag-sys.com
ads.us.e-planning.net
10 prebid-match.dotomi.com 10 redirects
9 token.rubiconproject.com 5 redirects eus.rubiconproject.com
9 s.amazon-adsystem.com 2 redirects ssum.casalemedia.com
onetag-sys.com
ads.us.e-planning.net
ads.pubmatic.com
9 pixel.tapad.com 6 redirects api.retargetly.com
ads.pubmatic.com
ads.us.e-planning.net
8 image2.pubmatic.com ads.pubmatic.com
8 match.prod.bidr.io 8 redirects
8 sync.adkernel.com ads.us.e-planning.net
sync.adkernel.com
onetag-sys.com
8 eus.rubiconproject.com ads.us.e-planning.net
eus.rubiconproject.com
sync.adkernel.com
7 dsum-sec.casalemedia.com 1 redirects ssum.casalemedia.com
7 sync.1rx.io 7 redirects
6 ups.analytics.yahoo.com 3 redirects onetag-sys.com
6 bh.contextweb.com 6 redirects
5 app.retargetly.com api.retargetly.com
5 pr-bh.ybp.yahoo.com 3 redirects ssum.casalemedia.com
ads.pubmatic.com
5 rtb.mfadsrvr.com 5 redirects
5 sync.mathtag.com 5 redirects
5 pixel-sync.sitescout.com 5 redirects
4 px.ads.linkedin.com eb2.3lift.com
ads.us.e-planning.net
4 pdp-service.retargetly.com 1 redirects ads.us.e-planning.net
pdp-cdn.retargetly.com
4 prebid.a-mo.net 3 redirects ads.us.e-planning.net
4 t.adx.opera.com 4 redirects
4 ads.stickyadstv.com 3 redirects ssum.casalemedia.com
4 api.retargetly.com 1 redirects s.e-planning.net
api.retargetly.com
4 dis.criteo.com ssum.casalemedia.com
eb2.3lift.com
ads.pubmatic.com
4 secure-assets.rubiconproject.com 4 redirects
4 sync.richaudience.com 4 redirects
4 s.e-planning.net ads.us.e-planning.net
3 beacon.lynx.cognitivlabs.com 2 redirects ads.pubmatic.com
3 image8.pubmatic.com onetag-sys.com
3 ssbsync-global.smartadserver.com onetag-sys.com
3 cs.admanmedia.com 3 redirects
3 pixel-eu.rubiconproject.com onetag-sys.com
3 image6.pubmatic.com ads.pubmatic.com
3 um.simpli.fi 3 redirects
3 ssum.casalemedia.com 1 redirects ads.us.e-planning.net
3 ads.pubmatic.com ads.us.e-planning.net
ads.pubmatic.com
3 sync.targeting.unrulymedia.com 3 redirects
3 ad.turn.com 3 redirects
3 match.sharethrough.com 2 redirects ads.us.e-planning.net
3 rtb.openx.net 3 redirects
3 ads.us.e-planning.net 1 redirects sync.adkernel.com
2 idsync.rlcdn.com 2 redirects
2 simage4.pubmatic.com ads.pubmatic.com
2 px.owneriq.net 2 redirects
2 pmp.mxptint.net 1 redirects ads.pubmatic.com
2 pubmatic-match.dotomi.com 2 redirects
2 sync-tm.everesttech.net 1 redirects ads.pubmatic.com
2 sync.technoratimedia.com 2 redirects
2 ce.lijit.com 1 redirects ads.us.e-planning.net
2 pixel-us-east.rubiconproject.com 2 redirects
2 sync.smartadserver.com 1 redirects api.retargetly.com
2 bcp.crwdcntrl.net api.retargetly.com
ads.us.e-planning.net
2 retargetly-match.dotomi.com 2 redirects
2 capi.connatix.com ssum.casalemedia.com
ads.us.e-planning.net
2 dpm.demdex.net 1 redirects ssum.casalemedia.com
2 secure.adnxs.com 2 redirects
2 a.sportradarserving.com 2 redirects
2 rtb.gumgum.com ads.us.e-planning.net
2 tags.crwdcntrl.net s.e-planning.net
2 p.rfihub.com 2 redirects
2 casale-match.dotomi.com 2 redirects
2 i.liadm.com 2 redirects
2 gw-iad-bid.ymmobi.com 2 redirects
2 cm-x.mgid.com 2 redirects
2 sync.colossusssp.com ads.us.e-planning.net
2 cookies.nextmillmedia.com 2 redirects
2 rtb.om-meta.com 2 redirects
2 sync.go.sonobi.com 2 redirects
2 sync.admanmedia.com ads.us.e-planning.net
2 sync.crwdcntrl.net 2 redirects
1 pippio.com 1 redirects
1 synchroscript.deliveryengine.adswizz.com ads.us.e-planning.net
1 match.adsby.bidtheatre.com 1 redirects
1 crb.kargo.com ads.pubmatic.com
1 core.iprom.net ads.pubmatic.com
1 matching.truffle.bid ads.pubmatic.com
1 ipac.ctnsnet.com ads.pubmatic.com
1 image4.pubmatic.com ads.pubmatic.com
1 rtb.adstanding.com 1 redirects
1 cms.quantserve.com 1 redirects
1 ssum-sec.casalemedia.com 1 redirects
1 rtb-csync.smartadserver.com 1 redirects
1 r.bidswitch.net 1 redirects
1 hb.yahoo.net ads.us.e-planning.net
1 sync1.intentiq.com ads.us.e-planning.net
1 sync.intentiq.com 1 redirects
1 live.primis.tech 1 redirects
1 sync.teads.tv api.retargetly.com
1 cms.analytics.yahoo.com 1 redirects
1 s.company-target.com 1 redirects
1 pdp-cdn.retargetly.com api.retargetly.com
1 cm.adform.net sync.adkernel.com
1 id.a-mx.com 1 redirects
1 dsum.casalemedia.com ssum.casalemedia.com
0 sync.bfmio.com Failed ads.pubmatic.com
0 us-u.openx.net Failed ads.pubmatic.com
0 thrtle.com Failed ads.pubmatic.com
0 gocm.c.appier.net Failed ads.pubmatic.com
0 ad.mrtnsvr.com Failed ads.pubmatic.com
0 c1.adform.net Failed ads.pubmatic.com
0 rtb.adentifi.com Failed ads.pubmatic.com
0 sync.ipredictive.com Failed ads.pubmatic.com
0 us01.z.antigena.com Failed ads.pubmatic.com
0 ums.acuityplatform.com Failed ads.pubmatic.com
0 csync.loopme.me Failed ads.pubmatic.com
0 sync.srv.stackadapt.com Failed ads.pubmatic.com
0 a.tribalfusion.com Failed ads.pubmatic.com
0 pm.w55c.net Failed ads.pubmatic.com
0 match.deepintent.com Failed ads.pubmatic.com
0 aax-eu.amazon-adsystem.com Failed ads.us.e-planning.net
0 serverf5.idsyncmxedge.com Failed api.retargetly.com
0 idsyncmxedge.com Failed api.retargetly.com
0 creativecdn.com Failed ssum.casalemedia.com
ads.pubmatic.com
0 b1sync.zemanta.com Failed ads.us.e-planning.net
0 global.ib-ibi.com Failed ads.us.e-planning.net
0 eexsync.com Failed ads.us.e-planning.net
273 126

This site contains no links.

Subject Issuer Validity Valid
ads.us.e-planning.net
R3
2024-02-06 -
2024-05-06
3 months crt.sh
*.admanmedia.com
Go Daddy Secure Certificate Authority - G2
2023-04-20 -
2024-05-21
a year crt.sh
*.e-planning.net
R3
2024-02-06 -
2024-05-06
3 months crt.sh
*.colossusssp.com
Go Daddy Secure Certificate Authority - G2
2023-09-08 -
2024-10-09
a year crt.sh
*.rubiconproject.com
DigiCert TLS Hybrid ECC SHA384 2020 CA1
2023-03-07 -
2024-04-03
a year crt.sh
*.pubmatic.com
DigiCert TLS RSA SHA256 2020 CA1
2023-11-26 -
2024-11-26
a year crt.sh
casalemedia.com
Cloudflare Inc ECC CA-3
2023-05-21 -
2024-05-20
a year crt.sh
*.retargetly.com
R3
2023-12-21 -
2024-03-20
3 months crt.sh
*.onetag-sys.com
DigiCert Global G3 TLS ECC SHA384 2020 CA1
2024-01-23 -
2025-01-29
a year crt.sh
*.crwdcntrl.net
Amazon RSA 2048 M01
2023-10-08 -
2024-11-05
a year crt.sh
dev.eks.va.adexchange.gumgum.com
Amazon RSA 2048 M02
2023-11-17 -
2024-12-15
a year crt.sh
*.3lift.com
Amazon RSA 2048 M02
2023-04-13 -
2024-05-11
a year crt.sh
*.adkernel.com
AlphaSSL CA - SHA256 - G4
2024-01-12 -
2025-02-12
a year crt.sh
*.smartadserver.com
DigiCert Global G3 TLS ECC SHA384 2020 CA1
2024-01-17 -
2025-01-16
a year crt.sh
ups.analytics.yahoo.com
DigiCert SHA2 High Assurance Server CA
2023-12-26 -
2024-06-19
6 months crt.sh
*.bidswitch.net
Sectigo RSA Domain Validation Secure Server CA
2023-03-23 -
2024-03-23
a year crt.sh
*.ybp.yahoo.com
DigiCert SHA2 High Assurance Server CA
2024-02-12 -
2024-08-07
6 months crt.sh
*.ads.stickyadstv.com
DigiCert Global G2 TLS RSA SHA256 2020 CA1
2023-04-19 -
2024-05-19
a year crt.sh
capi.connatix.com
GTS CA 1P5
2024-01-16 -
2024-04-15
3 months crt.sh
teads.tv
R3
2024-01-22 -
2024-04-21
3 months crt.sh
*.g.doubleclick.net
GTS CA 1C3
2024-01-29 -
2024-04-22
3 months crt.sh
www.linkedin.com
DigiCert SHA2 Secure Server CA
2024-01-30 -
2024-07-30
6 months crt.sh
*.criteo.com
DigiCert Global G2 TLS RSA SHA256 2020 CA1
2024-02-08 -
2024-05-07
3 months crt.sh
*.adnxs.com
GeoTrust ECC CA 2018
2023-02-13 -
2024-03-15
a year crt.sh
s.amazon-adsystem.com
Amazon RSA 2048 M01
2024-01-01 -
2024-12-21
a year crt.sh
*.everesttech.net
GlobalSign Atlas R3 DV TLS CA 2023 Q3
2023-08-11 -
2024-09-11
a year crt.sh
beacon.lynx.cognitivlabs.com
Amazon RSA 2048 M02
2023-03-31 -
2024-04-28
a year crt.sh
*.ctnsnet.com
DigiCert Global G2 TLS RSA SHA256 2020 CA1
2023-10-13 -
2024-11-10
a year crt.sh
truffle.bid
R3
2024-01-08 -
2024-04-07
3 months crt.sh
*.iprom.net
R3
2024-02-10 -
2024-05-10
3 months crt.sh
*.prod.use1.green.ops.kargo.com
Amazon RSA 2048 M03
2023-12-11 -
2025-01-08
a year crt.sh
deliveryengine.adswizz.com
Amazon RSA 2048 M02
2023-07-04 -
2024-08-01
a year crt.sh
*.tapad.com
DigiCert Global G2 TLS RSA SHA256 2020 CA1
2023-09-18 -
2024-09-17
a year crt.sh

This page contains 52 frames:

Primary Page: https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ct=1&ruidm=1&du=//sync.adkernel.com/user-sync?zone=181225&dsp=629319&t=iframe&uid=$uid&gdpr=1&gdpr_consent=cp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa&us_privacy=1---
Frame ID: CD621CAEC182AF7CD9D8E40B2ED9C53C
Requests: 25 HTTP requests in this frame

Frame: https://eus.rubiconproject.com/usync.html?&p=eplanning_east&endpoint=us-east
Frame ID: 8D5DC0CDEA9E7D3277CDA37BDB3E45DF
Requests: 20 HTTP requests in this frame

Frame: https://ads.pubmatic.com/AdServer/js/user_sync.html?p=156631&s=&predirect=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3Da208d9366469aa64%26fi%3Db811aede6e4aa661%26uid%3D
Frame ID: 37F78F1B0B449A8FE475E1E511097B15
Requests: 28 HTTP requests in this frame

Frame: https://ssum.casalemedia.com/usermatch?cb=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3D99e41df815fd80b4%26fi%3Db811aede6e4aa661%26uid%3D&s=190243&C=1
Frame ID: CC22E270C64DB0B9642DABD84B6F7F26
Requests: 10 HTTP requests in this frame

Frame: https://onetag-sys.com/usync/?pubId=5927d926323dc2c
Frame ID: CF3DEF5147EDD0E92F143B73D919806C
Requests: 20 HTTP requests in this frame

Frame: https://rtb.gumgum.com/usync/15581?r=https%3A%2F%2Fsync.e-planning.net%2Fum%3Fdc%3D1a6b1d3b3872943b%26fi%3Db811aede6e4aa661%26uid%3D
Frame ID: 6AFFE81E2CFFE2BCC55EA515041459A1
Requests: 1 HTTP requests in this frame

Frame: https://eb2.3lift.com/sync?redir=https%3A%2F%2Fsync.e-planning.net%2Fum%3Fuid%3D%24UID%26dc%3D4d76b6ce34af74c9%26iss%3D1&ld=1
Frame ID: 1673E31A96BDD89EF8FB01E9C119B490
Requests: 12 HTTP requests in this frame

Frame: https://u-iad04.e-planning.net/um?uid=A6959061943293596778&dc=eba3ecb667ab30ab&fi=b811aede6e4aa661
Frame ID: CF1AA1BBD6B3D8DFF23C999F7E8A645F
Requests: 4 HTTP requests in this frame

Frame: https://sync.adkernel.com/user-sync?zone=181225
Frame ID: FE198709181B5CCD3ABEC2789E7DCE46
Requests: 2 HTTP requests in this frame

Frame: https://onetag-sys.com/usync/?pubId=5adb88524e24e50
Frame ID: 042F2B8ED29E06589DA6942AE25CD7AD
Requests: 20 HTTP requests in this frame

Frame: https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ruidm=1&du=%2F%2Fsync.adkernel.com%2Fuser-sync%3Fzone%3D181225%26dsp%3D629319%26t%3Diframe%26uid%3D%24UID
Frame ID: 7C3BCDCABBF09A9347446D00404DD9A0
Requests: 21 HTTP requests in this frame

Frame: https://eus.rubiconproject.com/usync.html?p=adkernel
Frame ID: 2B84155F8C946B3DD5F0F2D71B7803D3
Requests: 4 HTTP requests in this frame

Frame: https://eus.rubiconproject.com/usync.html?&p=eplanning_east&endpoint=us-east
Frame ID: 237A97A5360AC8F59A6041308BA2D0A5
Requests: 4 HTTP requests in this frame

Frame: https://ads.pubmatic.com/AdServer/js/user_sync.html?p=156631&s=&predirect=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3Da208d9366469aa64%26fi%3Dea0631bf693866ce%26uid%3D
Frame ID: C917EBD6F1CC67B17BBF8D1958832177
Requests: 6 HTTP requests in this frame

Frame: https://ssum.casalemedia.com/usermatch?s=190243&cb=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3D99e41df815fd80b4%26fi%3Dea0631bf693866ce%26uid%3D
Frame ID: CD31821CD5BE72E2F73820C016BA9D23
Requests: 10 HTTP requests in this frame

Frame: https://api.retargetly.com/api?id=1473&src=0&url=https%3A%2F%2Fads.us.e-planning.net%2Fuspd%2F1%2F29f836b1c2dd7f7b%3Fct%3D1%26ruidm%3D1%26du%3D%2F%2Fsync.adkernel.com%2Fuser-sync%3Fzone%3D181225%26dsp%3D629319%26t%3Diframe%26uid%3D%24uid%26gdpr%3D1%26gdpr_consent%3Dcp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa%26us_privacy%3D1---&browserUrl=https%3A%2F%2Fads.us.e-planning.net%2Fuspd%2F1%2F29f836b1c2dd7f7b%3Fct%3D1%26ruidm%3D1%26du%3D%2F%2Fsync.adkernel.com%2Fuser-sync%3Fzone%3D181225%26dsp%3D629319%26t%3Diframe%26uid%3D%24uid%26gdpr%3D1%26gdpr_consent%3Dcp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa%26us_privacy%3D1---&ref=&utmz=&n=&md=&mk=&il=0&limit_drop=&userid=4a23b8ef-e0b1-4e48-8a8e-0462f462fd31&fullVersionList=&platform=&_rlid=4a23b8ef-e0b1-4e48-8a8e-0462f462fd31
Frame ID: C7C5E4D7F4A6E5026FA7659925EFB309
Requests: 13 HTTP requests in this frame

Frame: https://onetag-sys.com/usync/?pubId=5927d926323dc2c
Frame ID: D07DA2C32529DD545D087F04175EF379
Requests: 20 HTTP requests in this frame

Frame: https://rtb.gumgum.com/usync/15581?r=https%3A%2F%2Fsync.e-planning.net%2Fum%3Fdc%3D1a6b1d3b3872943b%26fi%3Dea0631bf693866ce%26uid%3D
Frame ID: 8486C6438B9628BB0C88B8C78ADFEB43
Requests: 1 HTTP requests in this frame

Frame: https://eb2.3lift.com/sync?redir=https%3A%2F%2Fsync.e-planning.net%2Fum%3Fuid%3D%24UID%26dc%3D4d76b6ce34af74c9%26iss%3D1&ld=1
Frame ID: 4CAA3A223920A85348E618DA0786932B
Requests: 12 HTTP requests in this frame

Frame: https://sync.adkernel.com/user-sync?zone=202990&r=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D%7BUID%7D%26dc%3Deba3ecb667ab30ab%26fi%3Dea0631bf693866ce
Frame ID: 64690463E7FA4BB08777F1B501E30FA0
Requests: 3 HTTP requests in this frame

Frame: https://sync.adkernel.com/user-sync?zone=181225&dsp=629319&t=iframe&uid=APTMFLEiYFm2nmK-
Frame ID: 16DC2EACE3A996990E72CE976C9D46C4
Requests: 1 HTTP requests in this frame

Frame: https://eus.rubiconproject.com/usync.html?p=adkernel
Frame ID: 5EFADCC69C94AF4A99A418850E39AB18
Requests: 4 HTTP requests in this frame

Frame: https://s.amazon-adsystem.com/dcm?pid=3b882453-6770-4785-baf8-a598533c054a&id=CBF00FF6-FEA1-42AB-B113-53FFB027089E&redir=true&gdpr=0&gdpr_consent=
Frame ID: 8C988A53F48F6A5CB35170F1C4E99BAE
Requests: 1 HTTP requests in this frame

Frame: https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTc4JnRsPTE1NzY4MDA=&piggybackCookie=3070257596522025748&gdpr=0&gdpr_consent=
Frame ID: ACCBB3E5C39CB3F9F5051111163DC4EB
Requests: 1 HTTP requests in this frame

Frame: https://image2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTMyOTcmdGw9MTI5NjAw&piggybackCookie=AABuLU7LrJsAABIZa6sJCw&gdpr=0
Frame ID: BDF49F259E8F9C1D3D1B7E9C765F2DFD
Requests: 1 HTTP requests in this frame

Frame: https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTMzMDEmdGw9MTI5NjAw&piggybackCookie=807f0ffa-d0ee-11ee-b8b5-8e4fa7d130c9
Frame ID: E407D77A5A408D8C4626451A4472A81D
Requests: 1 HTTP requests in this frame

Frame: https://sync-tm.everesttech.net/ct/upi/pid/b9pj45k4?redir=https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZqcz0xJmNvZGU9MjE5MSZ0bD0yNTkyMDA=&piggybackCookie=${TM_USER_ID}&gdpr=1&gdpr_consent=&_test=ZdZNWAAGp4zQ9ABK
Frame ID: B12730F145E0B720E9E250D4F595EA9B
Requests: 1 HTTP requests in this frame

Frame: https://match.deepintent.com/usersync/141?gdpr=0&gdpr_consent=
Frame ID: 6C83B787C0AD488BA495F3B109EB40A9
Requests: 1 HTTP requests in this frame

Frame: https://image2.pubmatic.com/AdServer/Pug?gdpr=0&vcode=bz0yJnR5cGU9MSZjb2RlPTExMTMmdGw9NDMyMDA=&piggybackCookie=kl-aqpAOy6WJWcqox1rT_sBYyauJWZv4kV-Yqc5k
Frame ID: 96B7937883CC7C02702B89AB1CC35E96
Requests: 1 HTTP requests in this frame

Frame: https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZqcz0xJmNvZGU9Mjk0NSZ0bD0xMjk2MDA=&piggybackCookie=289bf088-0272-4e59-b62a-13b557cc5d81&gdpr=&gdpr_consent=&gdpr_pd=&us_privacy=
Frame ID: 49F133BBE98CDDDBD73C7F49C91BB9CB
Requests: 1 HTTP requests in this frame

Frame: https://image2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTI3MzkmdGw9MTI5NjAw&piggybackCookie=1813050729988763840
Frame ID: 08FCA4770C1FF5ED72056676F880C0ED
Requests: 1 HTTP requests in this frame

Frame: https://pm.w55c.net/ping_match.gif?ei=PUBMATIC&rurl=https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTMwNzQmdGw9MTI5NjAw&piggybackCookie=uid:_wfivefivec_&gdpr=0&gdpr_consent=
Frame ID: E370550F73749FA548E8C42E09EAEEFB
Requests: 1 HTTP requests in this frame

Frame: https://beacon.lynx.cognitivlabs.com/pbmtc.gif?puid=CBF00FF6-FEA1-42AB-B113-53FFB027089E
Frame ID: 52624E84DC1536BCD40F996B2B3FCA7B
Requests: 1 HTTP requests in this frame

Frame: https://a.tribalfusion.com/i.match?p=b11&redirect=https%3A//simage2.pubmatic.com/AdServer/Pug%3Fvcode%3Dbz0yJnR5cGU9MSZjb2RlPTMzMjYmdGw9MTI5NjAw%26piggybackCookie%3D%24TF_USER_ID_ENC%24&u=${PUBMATIC_UID}
Frame ID: ABACEE218286071D9B430A1FFCE19486
Requests: 1 HTTP requests in this frame

Frame: https://dis.criteo.com/dis/usersync.aspx?r=3&p=4&cp=pubmaticUS&cu=1&&gdpr=0&gdpr_consent=&url=https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTE5MjgmdGw9NDMyMDA=&piggybackCookie=uid:@@CRITEO_USERID@@
Frame ID: D1A0EA8B34D8D4831F1D94044D0309C7
Requests: 1 HTTP requests in this frame

Frame: https://sync.srv.stackadapt.com/sync?nid=11&gdpr=0&gdpr_consent=
Frame ID: C2E9EC613EBEC47701E38AA1007A11F8
Requests: 1 HTTP requests in this frame

Frame: https://csync.loopme.me/?pubid=11331&redirect=https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTM0MzImdGw9MTI5NjAw&piggybackCookie={viewer_token}&gdpr=0&gdpr_consent=
Frame ID: CE981C8755CD3B902B1FDAFCACBDC31C
Requests: 1 HTTP requests in this frame

Frame: https://ums.acuityplatform.com/tum?umid=6
Frame ID: CAC5CE1B00289F8F91EA2DD7F3FA4852
Requests: 1 HTTP requests in this frame

Frame: https://u-iad04.e-planning.net/um?dc=a208d9366469aa64&fi=b811aede6e4aa661&uid=CBF00FF6-FEA1-42AB-B113-53FFB027089E
Frame ID: B9F7B4916695E4F2CDE3ACC15E1D5AC2
Requests: 1 HTTP requests in this frame

Frame: https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTM2MiZ0bD0xMjk2MDA==&piggybackCookie=uid:7d3865d6-4d56-4600-8c23-a9a5b19c894d&gdpr=0&gdpr_consent=
Frame ID: C85D3C20A48A66B138BBD50B1205FB74
Requests: 1 HTTP requests in this frame

Frame: https://image2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTM0ODkmdGw9NDMyMDA=&piggybackCookie=OPU27f663e31dbb44e08d62ff8e96f2f82f
Frame ID: 8E6DD875627428C25CD73584B57A0D5F
Requests: 1 HTTP requests in this frame

Frame: https://ad.mrtnsvr.com/sync/pubmatic?gdpr=0&gdpr_consent=
Frame ID: C1F60EB9A6D1B223E70EF6E1DC09F332
Requests: 1 HTTP requests in this frame

Frame: https://gocm.c.appier.net/pubmatic
Frame ID: 04368CF7FBFEF6097C6EAA7DCF44AA1C
Requests: 1 HTTP requests in this frame

Frame: https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTMyMDMmdGw9NDMyMDA=&piggybackCookie=RX-704c440e-c06a-4152-9309-008e3de3e6e8-005
Frame ID: 65486D96C9B4B13CC73A9A98B92D56CE
Requests: 1 HTTP requests in this frame

Frame: https://ipac.ctnsnet.com/int/cm?exc=14&redir=https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTM0MTEmdGw9MjAxNjA=&piggybackCookie=[user_id]
Frame ID: B7EF8BAFF77A67794D12084727A6CE48
Requests: 1 HTTP requests in this frame

Frame: https://matching.truffle.bid/sync/pub?sid=161&suid=https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTM0NDQmdGw9MjAxNjA=&piggybackCookie=$UID
Frame ID: E711A1E250AC4C821ED489D14D2C77E4
Requests: 1 HTTP requests in this frame

Frame: https://core.iprom.net/cookiesync?gdpr=0&gdpr_consent=
Frame ID: 9AFCA103ACA1A641D591B96F20EA2812
Requests: 1 HTTP requests in this frame

Frame: https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTMwNzMmdGw9MTI5NjAw&piggybackCookie=Q7618297251980074131
Frame ID: 4461167D8ADB777E93C8F2933BA998C1
Requests: 1 HTTP requests in this frame

Frame: https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZqcz0xJmNvZGU9MjkzNiZ0bD00MzIwMA==&piggybackCookie=uid:F9F3D2AF329649C7860431F114E065D0&gdpr=0&gdpr_consent=
Frame ID: 7DC39ED69BBDBA928C175B1CAC248961
Requests: 1 HTTP requests in this frame

Frame: https://u-iad04.e-planning.net/um?dc=a208d9366469aa64&fi=b811aede6e4aa661&uid=CBF00FF6-FEA1-42AB-B113-53FFB027089E
Frame ID: 08D7A6FA806CE4DA3F70A025A5FD7470
Requests: 1 HTTP requests in this frame

Frame: https://u-iad04.e-planning.net/um?dc=a208d9366469aa64&fi=ea0631bf693866ce&uid=CBF00FF6-FEA1-42AB-B113-53FFB027089E
Frame ID: F0FC26A7FA2D1FDD02DD63179A5FE919
Requests: 1 HTTP requests in this frame

Frame: https://u-iad04.e-planning.net/um?dc=a208d9366469aa64&fi=ea0631bf693866ce&uid=CBF00FF6-FEA1-42AB-B113-53FFB027089E
Frame ID: 78F7139FDDA47DA0A0575FB4F6DDAF6A
Requests: 1 HTTP requests in this frame

Screenshot


Page URL History Show full URLs

  1. https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ruidm=1&du=//sync.adkernel.com/user-sync?zone=181225... HTTP 302
    https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ct=1&ruidm=1&du=//sync.adkernel.com/user-sync?zone=1... Page URL

Detected technologies

Overall confidence: 100%
Detected patterns
  • <(?:iframe|img)[^>]+adnxs\.(?:net|com)
  • adnxs\.(?:net|com)

Overall confidence: 100%
Detected patterns
  • adnxs\.com/[^"]*(?:prebid|/pb\.js)

Overall confidence: 100%
Detected patterns
  • https?://[^/]*\.pubmatic\.com

Overall confidence: 100%
Detected patterns
  • https?://[^/]*\.rubiconproject\.com

Page Statistics

273
Requests

42 %
HTTPS

0 %
IPv6

89
Domains

126
Subdomains

53
IPs

7
Countries

217 kB
Transfer

405 kB
Size

174
Cookies

Page URL History

This captures the URL locations of the websites, including HTTP redirects and client-side redirects via JavaScript or Meta fields.

  1. https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ruidm=1&du=//sync.adkernel.com/user-sync?zone=181225&dsp=629319&t=iframe&uid=$uid&gdpr=1&gdpr_consent=cp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa&us_privacy=1--- HTTP 302
    https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ct=1&ruidm=1&du=//sync.adkernel.com/user-sync?zone=181225&dsp=629319&t=iframe&uid=$uid&gdpr=1&gdpr_consent=cp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa&us_privacy=1--- Page URL

Redirected requests

There were HTTP redirect chains for the following requests:

Request Chain 0
  • https://pixel-sync.sitescout.com/dmp/pixelSync?nid=49&redir=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D%7BuserId%7D%26dc%3D0abbcb4eba840e59%26fi%3Db811aede6e4aa661 HTTP 302
  • https://pixel-sync.sitescout.com/dmp/pixelSync?cookieQ=1&nid=49&redir=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D%7BuserId%7D%26dc%3D0abbcb4eba840e59%26fi%3Db811aede6e4aa661 HTTP 302
  • https://sync.crwdcntrl.net/qmap?c=1389&tp=STSC&tpid=3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553&gdpr=0&gdpr_consent=&d=https%3A%2F%2Fpixel.tapad.com%2Fidsync%2Fex%2Fpush%3Fpartner_id%3D2499%26partner_device_id%3D3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553%26partner_url%3Dhttps%253A%252F%252Fsync.e-planning.net%252Fum%253Fuid%253D3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553%2526dc%253D0abbcb4eba840e59%2526iss%253D1 HTTP 302
  • https://sync.crwdcntrl.net/qmap?c=1389&tp=STSC&tpid=3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553&gdpr=0&gdpr_consent=&d=https%3A%2F%2Fpixel.tapad.com%2Fidsync%2Fex%2Fpush%3Fpartner_id%3D2499%26partner_device_id%3D3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553%26partner_url%3Dhttps%253A%252F%252Fsync.e-planning.net%252Fum%253Fuid%253D3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553%2526dc%253D0abbcb4eba840e59%2526iss%253D1&ct=y HTTP 302
  • https://pixel.tapad.com/idsync/ex/push?partner_id=2499&partner_device_id=3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553&partner_url=https%3A%2F%2Fsync.e-planning.net%2Fum%3Fuid%3D3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553%26dc%3D0abbcb4eba840e59%26iss%3D1 HTTP 302
  • https://pixel.tapad.com/idsync/ex/push/check?partner_id=2499&partner_device_id=3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553&partner_url=https%3A%2F%2Fsync.e-planning.net%2Fum%3Fuid%3D3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553%26dc%3D0abbcb4eba840e59%26iss%3D1 HTTP 302
  • https://sync.e-planning.net/um?uid=3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553&dc=0abbcb4eba840e59&iss=1
Request Chain 1
  • https://bh.contextweb.com/bh/rtset?pid=562965&ev=1&us_privacy=${us_privacy}&rurl=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D%%VGUID%%%26dc%3D66b7ef4184d94c10%26fi%3Db811aede6e4aa661 HTTP 302
  • https://u-iad04.e-planning.net/um?uid=rANRdsjgURNt&dc=66b7ef4184d94c10&fi=b811aede6e4aa661&ev=1&us_privacy=${us_privacy}&pid=562965
Request Chain 4
  • https://rtb.openx.net/sync/prebid?r=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3Dff96d1aa62deeebd%26fi%3Db811aede6e4aa661%26uid%3D%24%7BUID%7D HTTP 302
  • https://rtb.openx.net/sync/prebid?r=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3Dff96d1aa62deeebd%26fi%3Db811aede6e4aa661%26uid%3D%24%7BUID%7D&ox_sc=1 HTTP 302
  • https://u-iad04.e-planning.net/um?dc=ff96d1aa62deeebd&fi=b811aede6e4aa661&uid=f2b461ff-fb7e-412b-94b2-7e89668d3fb5
Request Chain 6
  • https://prebid-match.dotomi.com/match/bounce/current?networkId=72582&version=1&rurl=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3Dfbb23d0ef33aad5d%26fi%3Db811aede6e4aa661%26uid%3D HTTP 302
  • https://prebid-match.dotomi.com/match/bounce/current?DotomiTest=df16ac4cad80fbc&is_secure=true&networkId=72582&version=1&rurl=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3Dfbb23d0ef33aad5d%26fi%3Db811aede6e4aa661%26uid%3D HTTP 302
  • https://u-iad04.e-planning.net/um?dc=fbb23d0ef33aad5d&fi=b811aede6e4aa661&uid=AAAHP_bPND0F0ANDd10_AAAAAAA&expiration=1708629718
Request Chain 7
  • https://sync.richaudience.com/f7872c90c5d3791e2b51f7edce1a0a5d/?p=25BiP9IMgN&r=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D[PDID]%26dc%3Dfabfd6762b833237%26fi%3Db811aede6e4aa661 HTTP 302
  • https://sync.richaudience.com/f7872c90c5d3791e2b51f7edce1a0a5d/?p=25BiP9IMgN&r=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D[PDID]%26dc%3Dfabfd6762b833237%26fi%3Db811aede6e4aa661&rd=1 HTTP 302
  • https://u-iad04.e-planning.net/um?uid=deb741aa-2f28-4634-8160-1zz1708543296&dc=fabfd6762b833237&fi=b811aede6e4aa661
Request Chain 8
  • https://ib.adnxs.com/getuid?https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3D8103fa85295fbe60%26fi%3Db811aede6e4aa661%26uid%3D%24UID HTTP 307
  • https://ib.adnxs.com/bounce?%2Fgetuid%3Fhttps%253A%252F%252Fu-iad04.e-planning.net%252Fum%253Fdc%253D8103fa85295fbe60%2526fi%253Db811aede6e4aa661%2526uid%253D%2524UID HTTP 302
  • https://u-iad04.e-planning.net/um?dc=8103fa85295fbe60&fi=b811aede6e4aa661&uid=3070257596522025748
Request Chain 9
  • https://sync.go.sonobi.com/us?loc=%0A%0Ahttps%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3De52415579699e09f%26fi%3Db811aede6e4aa661%26uid%3D%5BUID%5D HTTP 302
  • https://u-iad04.e-planning.net/um?dc=e52415579699e09f&fi=b811aede6e4aa661&uid=8735f714-7c55-4ddf-b4aa-f391ce20c51c
Request Chain 10
  • https://rtb.om-meta.com/csync?exchange=41cd7873289762a3cc93a994250371cf1cd20569&rurl=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3Dbe1f3f8d2283c058%26fi%3Db811aede6e4aa661%26uid%3D HTTP 302
  • https://u-iad04.e-planning.net/um?dc=be1f3f8d2283c058&fi=b811aede6e4aa661&uid=e61d01e1-01f4-4529-9149-29c5971b856a
Request Chain 11
  • https://ssp.disqus.com/redirectuser?r=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3De64f73568d2b3c34%26fi%3Db811aede6e4aa661%26uid%3D%24UID&partner=eplanning HTTP 302
  • https://eexsync.com/ztgl358.gif?gdpr=0&gdpr_consent=&us_privacy=&coppa=&redir=https%3A%2F%2Fssp.disqus.com%2Fmatch%3Fbidder%3D38%26buyeruid%3D%7B%24PARTNER_UID%7D%26r%3DCid1YS02ODc2NTkyNC1lYzgzLTM3M2QtYTE5Ni0yZTNjNmFiNjBkZjUqdWh0dHBzOi8vdS1pYWQwNC5lLXBsYW5uaW5nLm5ldC91bT9kYz1lNjRmNzM1NjhkMmIzYzM0JmZpPWI4MTFhZWRlNmU0YWE2NjEmdWlkPXVhLTY4NzY1OTI0LWVjODMtMzczZC1hMTk2LTJlM2M2YWI2MGRmNTICJgY4AQ==
Request Chain 12
  • https://match.sharethrough.com/universal/v1?supply_id=H7IJBRjH HTTP 302
  • https://sync.e-planning.net/um?uid=b3cbfa3d-f13e-4b97-85b4-bce66903b033&dc=769fefa8321c94fb&iss=1
Request Chain 13
  • https://cookies.nextmillmedia.com/sync?type=image&gdpr={{.GDPR}}&gdpr_consent={{.GDPRConsent}}&us_privacy={{.USPrivacy}}&redirect=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D%5BNMUID%5D%26dc%3Db337141cfdc8cf59%26fi%3Db811aede6e4aa661 HTTP 302
  • https://u-iad04.e-planning.net/um?uid=&dc=b337141cfdc8cf59&fi=b811aede6e4aa661
Request Chain 15
  • https://x.bidswitch.net/sync?ssp=eplanning HTTP 302
  • https://x.bidswitch.net/ul_cb/sync?ssp=eplanning HTTP 302
  • https://odr.mookie1.com/t/v2/sync?tagid=V2_790378&src.visitorId=289bf088-0272-4e59-b62a-13b557cc5d81&ssp=eplanning&gdpr=&gdpr_consent= HTTP 302
  • https://global.ib-ibi.com/image.sbmx?go=298769&pid=541&xid=10597251405032412758&ssp=eplanning&gdpr=&gdpr_consent=
Request Chain 16
  • https://cm-x.mgid.com/7c66bfc34cae8636a9aefaf68cb9041c.gif?redir=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D%5BUID%5D%26dc%3D98bd04598763300f%26fi%3Db811aede6e4aa661 HTTP 302
  • https://u-iad04.e-planning.net/um?uid=055e2cac-afc1-40ce-a7db-0096e1f2ea42&dc=98bd04598763300f&fi=b811aede6e4aa661
Request Chain 17
  • https://gw-iad-bid.ymmobi.com/adx/user/sync?pubid=ZXBsYW5uaW5n&gdpr=${GDPR}&gdpr_consent=${GDPR_CONSENT}&us_privacy=${US_PRIVACY}&callback=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D%7Bym_user_id%7D%26dc%3Ddbfd729d40c9c3fc%26fi%3Db811aede6e4aa661 HTTP 302
  • https://u-iad04.e-planning.net/um?uid=ym_user_fd793f8a-22aa-4deb-bed6-b4a4ada902df&dc=dbfd729d40c9c3fc&fi=b811aede6e4aa661
Request Chain 18
  • https://sync.1rx.io/usersync2/rmpssp?sub=eplanning HTTP 302
  • https://sync.1rx.io/usersync2/rmpssp?sub=eplanning&zcc=1&cb=1708543318412 HTTP 302
  • https://ad.turn.com/r/cs?pid=45&rndcb=2042908897 HTTP 302
  • https://sync.1rx.io/usersync/turn/8394440862743660092?dspret=1&gdpr=&gdpr_consent=&us_privacy= HTTP 302
  • https://sync.targeting.unrulymedia.com/csync/RX-704c440e-c06a-4152-9309-008e3de3e6e8-005?redir=https%3A%2F%2Fsync.e-planning.net%2Fum%3Fuid%3DRX-704c440e-c06a-4152-9309-008e3de3e6e8-005%26dc%3Dfc741bbdfeedcd57%26iss%3D1 HTTP 302
  • https://sync.e-planning.net/um?uid=RX-704c440e-c06a-4152-9309-008e3de3e6e8-005&dc=fc741bbdfeedcd57&iss=1
Request Chain 19
  • https://secure-assets.rubiconproject.com/utils/xapi/multi-sync.html?&p=eplanning_east&endpoint=us-east HTTP 301
  • https://eus.rubiconproject.com/usync.html?&p=eplanning_east&endpoint=us-east
Request Chain 21
  • https://ssum.casalemedia.com/usermatch?s=190243&cb=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3D99e41df815fd80b4%26fi%3Db811aede6e4aa661%26uid%3D HTTP 302
  • https://ssum.casalemedia.com/usermatch?cb=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3D99e41df815fd80b4%26fi%3Db811aede6e4aa661%26uid%3D&s=190243&C=1
Request Chain 22
  • https://i.liadm.com/s/31327?bidder_id=14481&bidder_uuid=ZdZNVdHM4ZgAAAdJAE2s5QAA%262470&gpdr=&gdpr_consent=&us_privacy=&gpp=&gpp_sid= HTTP 303
  • https://i.liadm.com/s/31327?gdpr_consent=&bidder_id=14481&gpp=&bidder_uuid=ZdZNVdHM4ZgAAAdJAE2s5QAA%262470&_li_chk=true&gpp_sid=&us_privacy=&gpdr=&previous_uuid=6c4aeb2409f54e9a8b94d49da7fb3412 HTTP 303
  • https://dis.criteo.com/dis/usersync.aspx?r=77&p=311&cp=liveintent&cu=1&url=https://i.liadm.com/s/28292?bidder_id%3D71340%26bidder_uuid%3D@@CRITEO_USERID@@
Request Chain 23
  • https://s.amazon-adsystem.com/dcm?pid=78af914c-e755-4b90-bded-1b172aedc763&us_privacy=&gdpr=&gdpr_consent=&id=ZdZNVdHM4ZgAAAdJAE2s5QAACaYAAAAB&gpp=&gpp_sid= HTTP 302
  • https://s.amazon-adsystem.com/dcm?pid=78af914c-e755-4b90-bded-1b172aedc763&us_privacy=&gdpr=&gdpr_consent=&id=ZdZNVdHM4ZgAAAdJAE2s5QAACaYAAAAB&gpp=&gpp_sid=&dcc=t
Request Chain 24
  • https://cm.g.doubleclick.net/pixel?google_nid=index&google_cm&google_hm=ZdZNVdHM4ZgAAAdJAE2s5QAACaYAAAAB&gdpr_consent=&us_privacy=&gdpr=&gpp=&gpp_sid= HTTP 302
  • https://cm.g.doubleclick.net/pixel?google_nid=index&google_cm=&google_hm=ZdZNVdHM4ZgAAAdJAE2s5QAACaYAAAAB&gdpr_consent=&us_privacy=&gdpr=&gpp=&gpp_sid=&google_tc=
Request Chain 25
  • https://match.adsrvr.org/track/cmf/casale HTTP 302
  • https://match.adsrvr.org/track/cmb/casale HTTP 302
  • https://dsum-sec.casalemedia.com/rum?cm_dsp_id=39&external_user_id=ade1d398-3078-4488-aa7b-1c669b6286de&expiration=1711135318&gdpr=0&gdpr_consent=
Request Chain 26
  • https://casale-match.dotomi.com/match/bounce/current?networkId=19998&version=1 HTTP 302
  • https://casale-match.dotomi.com/match/bounce/current?DotomiTest=65f1f5dcd57d1215&is_secure=true&networkId=19998&version=1 HTTP 302
  • https://dsum.casalemedia.com/rum?cm_dsp_id=65&external_user_id=AAAHP_bPND0F0wMUd1UnAAAAAAA&expiration=1708629718&is_secure=true
Request Chain 27
  • https://um.simpli.fi/pm_match?https://dsum-sec.casalemedia.com/crum?cm_dsp_id=90&external_user_id=$UID HTTP 302
  • https://dsum-sec.casalemedia.com/crum?cm_dsp_id=90&external_user_id=F9F3D2AF329649C7860431F114E065D0
Request Chain 28
  • https://sync.mathtag.com/sync/img?mt_exid=15&redir=https%3A%2F%2Fdsum-sec.casalemedia.com%2Fcrum%3Fcm_dsp_id%3D3%26external_user_id%3D%5BMM_UUID%5D&us_privacy=&gdpr=&gdpr_consent= HTTP 302
  • https://dsum-sec.casalemedia.com/crum?cm_dsp_id=3&external_user_id=7d3865d6-4d56-4600-8c23-a9a5b19c894d&gdpr=&gdpr_consent=
Request Chain 29
  • https://p.rfihub.com/cm?in=1&pub=2079 HTTP 302
  • https://dsum-sec.casalemedia.com/crum?cm_dsp_id=57&external_user_id=1813050729988763840
Request Chain 35
  • https://eb2.3lift.com/sync?redir=https%3A%2F%2Fsync.e-planning.net%2Fum%3Fuid%3D%24UID%26dc%3D4d76b6ce34af74c9%26iss%3D1 HTTP 302
  • https://eb2.3lift.com/sync?redir=https%3A%2F%2Fsync.e-planning.net%2Fum%3Fuid%3D%24UID%26dc%3D4d76b6ce34af74c9%26iss%3D1&ld=1
Request Chain 40
  • https://rtb.mfadsrvr.com/sync?ssp=onetag&ssp_user_id=3PobiDqnnW2DwaFlGOAQZdyB3CiR7dkOFHWmEpuT8GQ HTTP 302
  • https://rtb.mfadsrvr.com/ul_cb/sync?ssp=onetag&ssp_user_id=3PobiDqnnW2DwaFlGOAQZdyB3CiR7dkOFHWmEpuT8GQ HTTP 302
  • https://onetag-sys.com/match/?int_id=160&uid=9fb2006b-9167-48df-b1b8-da147b8d8502
Request Chain 41
  • https://sync.mathtag.com/sync/img?mt_exid=75&redir=https%3A%2F%2Fonetag-sys.com%2Fmatch%2F%3Fint_id%3D1%26uid%3D%5BMM_UUID%5D%26gdpr%3D1%26gdpr_consent%3D HTTP 302
  • https://onetag-sys.com/match/?int_id=1&uid=7d3865d6-4d56-4600-8c23-a9a5b19c894d&gdpr=1&gdpr_consent=
Request Chain 43
  • https://ib.adnxs.com/getuid?https%3A%2F%2Fonetag-sys.com%2Fmatch%2F%3Fint_id%3D98%26gdpr%3D1%26gdpr_consent%3D%26uid%3D$UID HTTP 302
  • https://onetag-sys.com/match/?int_id=98&gdpr=1&gdpr_consent=&uid=3070257596522025748
Request Chain 44
  • https://ads.stickyadstv.com/user-matching?id=3679&gdpr=1&gdpr_consent= HTTP 302
  • https://onetag-sys.com/match/?int_id=3&uid=7c4531c196caee8848b74a0649cae&gdpr_consent=&gdpr=1
Request Chain 46
  • https://cs.admanmedia.com/73c1e1bfc3bde354d60b80e601ae3914.gif?puid=[UID]&redir=https%3A%2F%2Fonetag-sys.com%2Fmatch%2F%3Fint_id%3D164%26gdpr%3D%24%7BGDPR%7D%26gdpr_consent%3D%24%7BGDPR_STRING%7D%26uid%3D%5BUID%5D&gdpr=1&gdpr_consent=&ccpa=&coppa= HTTP 302
  • https://onetag-sys.com/match/?int_id=164&gdpr=${GDPR}&gdpr_consent=${GDPR_STRING}&uid=db308ea2-626b-4945-b685-2a60982c63dd
Request Chain 47
  • https://t.adx.opera.com/pub/sync?pubid=pub10101531197440 HTTP 302
  • https://onetag-sys.com/match/?gdpr=&gdpr_consent=%24%7BGDPR_STRING%7D&int_id=168&uid=OPUb233dc083fca42c6a6df45cf70a7f1fb
Request Chain 48
  • https://onetag-sys.com/match/?int_id=106&redir=1&ot_initiated=1 HTTP 302
  • https://cm.g.doubleclick.net/pixel?google_nid=one_tag&google_hm=AAABjc0eGI3IlRh7Q7INXRrtuDGvqDgsUa1a6w
Request Chain 50
  • https://onetag-sys.com/match/?int_id=113&gdpr=1&gdpr_consent=&callback=https%3A%2F%2Fs.amazon-adsystem.com%2Fecm3%3Fex%3Donetag.com%26id%3D%24%7BUSER_TOKEN%7D&ot_initiated=1 HTTP 302
  • https://s.amazon-adsystem.com/ecm3?ex=onetag.com&id=3PobiDqnnW2DwaFlGOAQZdyB3CiR7dkOFHWmEpuT8GQ
Request Chain 52
  • https://cm.g.doubleclick.net/pixel?google_nid=onetag_eb&google_cm HTTP 302
  • https://onetag-sys.com/match/?int_id=106&google_error=15
Request Chain 53
  • https://bh.contextweb.com/bh/rtset?pid=562985&ev=1&us_privacy=&rurl=https%3A%2F%2Fonetag-sys.com%2Fmatch%2F%3Fint_id%3D149%26gdpr%3D%24%7BGDPR%7D%26gdpr_consent%3D%24%7BGDPR_STRING%7D%26uid%3D%25%25VGUID%25%25 HTTP 302
  • https://onetag-sys.com/match/?int_id=149&gdpr=${GDPR}&gdpr_consent=${GDPR_STRING}&uid=rANRdsjgURNt&ev=1&us_privacy=&pid=562985
Request Chain 54
  • https://prebid-match.dotomi.com/match/bounce/current?version=1&networkId=72582&rurl=https%3A%2F%2Fonetag-sys.com%2Fmatch%2F%3Fint_id%3D90%26gdpr%3D0%26gdpr_consent%3D%26uid%3D HTTP 302
  • https://prebid-match.dotomi.com/match/bounce/current?DotomiTest=37929912c5c21215&is_secure=true&version=1&networkId=72582&rurl=https%3A%2F%2Fonetag-sys.com%2Fmatch%2F%3Fint_id%3D90%26gdpr%3D0%26gdpr_consent%3D%26uid%3D HTTP 302
  • https://onetag-sys.com/match/?int_id=90&gdpr=0&gdpr_consent=&uid=AAAGbJPf5zYNOgNNNPtMAAAAAAA&expiration=1708629718
Request Chain 56
  • https://match.adsrvr.org/track/cmf/generic?ttd_pid=vw6iyrn&ttd_tpi=1&gpdr=1&gdpr_consent= HTTP 302
  • https://match.adsrvr.org/track/cmb/generic?ttd_pid=vw6iyrn&ttd_tpi=1&gpdr=1&gdpr_consent= HTTP 302
  • https://onetag-sys.com/match/?int_id=29&uid=6ac759cd-581b-4dc6-abe7-46b63a59a046&gdpr=0&gdpr_consent=
Request Chain 59
  • https://ib.adnxs.com/getuid?%2F%2Fsync.adkernel.com%2Fuser-sync%3Fzone%3D181225%26dsp%3D578434%26t%3Dimage%26uid%3D%24UID HTTP 302
  • https://sync.adkernel.com/user-sync?zone=181225&dsp=578434&t=image&uid=3070257596522025748
Request Chain 60
  • https://prebid.a-mo.net/cchain/0?&cb=%2F%2Fsync.adkernel.com%2Fuser-sync%3Fzone%3D202990%26dsp%3D629501%26t%3Dimage%26uid%3D HTTP 302
  • https://ib.adnxs.com/getuid?https%3A%2F%2Fprebid.a-mo.net%2Fcchain%2F0%2F4849%3Fgpp%3D%26gdpr_consent%3D%26gdpr%3D%26gpp_sid%3D%26us_privacy%3D%26A%3D4fca736c-74b7-4f0b-8926-f1464591893a%26bidder%3Dappnexus%26cbx%3DLy9zeW5jLmFka2VybmVsLmNvbS91c2VyLXN5bmM_em9uZT0yMDI5OTAmZHNwPTYyOTUwMSZ0PWltYWdlJnVpZD0%253D%26uid%3D%24UID HTTP 302
  • https://prebid.a-mo.net/cchain/0/4849?gpp=&gdpr_consent=&gdpr=&gpp_sid=&us_privacy=&A=4fca736c-74b7-4f0b-8926-f1464591893a&bidder=appnexus&cbx=Ly9zeW5jLmFka2VybmVsLmNvbS91c2VyLXN5bmM_em9uZT0yMDI5OTAmZHNwPTYyOTUwMSZ0PWltYWdlJnVpZD0%3D&uid=3070257596522025748 HTTP 302
  • https://id.a-mx.com/u?&gdpr=0&us_privacy=1---&cb=https%3A%2F%2Fprebid.a-mo.net%2Fcchain%2F1%2F4849%3Fgpp%3D%26gdpr_consent%3D%26gdpr%3D%26gpp_sid%3D%26us_privacy%3D%26A%3D4fca736c-74b7-4f0b-8926-f1464591893a%26bidder%3Damx_com%26cbx%3DLy9zeW5jLmFka2VybmVsLmNvbS91c2VyLXN5bmM_em9uZT0yMDI5OTAmZHNwPTYyOTUwMSZ0PWltYWdlJnVpZD0%253D%26uid%3D HTTP 302
  • https://prebid.a-mo.net/cchain/1/4849?gpp=&gdpr_consent=&gdpr=&gpp_sid=&us_privacy=&A=4fca736c-74b7-4f0b-8926-f1464591893a&bidder=amx_com&cbx=Ly9zeW5jLmFka2VybmVsLmNvbS91c2VyLXN5bmM_em9uZT0yMDI5OTAmZHNwPTYyOTUwMSZ0PWltYWdlJnVpZD0%3D&uid=4fca736c-74b7-4f0b-8926-f1464591893a HTTP 302
  • https://cm.adform.net/cookie?&gdpr=0&us_privacy=1---&redirect_url=https%3A%2F%2Fprebid.a-mo.net%2Fcchain%2F2%2F4849%3Fgpp%3D%26gdpr_consent%3D%26gdpr%3D%26gpp_sid%3D%26us_privacy%3D%26A%3D4fca736c-74b7-4f0b-8926-f1464591893a%26bidder%3Dadform%26cbx%3DLy9zeW5jLmFka2VybmVsLmNvbS91c2VyLXN5bmM_em9uZT0yMDI5OTAmZHNwPTYyOTUwMSZ0PWltYWdlJnVpZD0%253D%26uid%3D%24UID
Request Chain 61
  • https://ib.adnxs.com/getuid?%2F%2Fsync.adkernel.com%2Fuser-sync%3Fzone%3D202990%26dsp%3D649145%26t%3Dimage%26uid%3D%24UID HTTP 302
  • https://sync.adkernel.com/user-sync?zone=202990&dsp=649145&t=image&uid=3070257596522025748
Request Chain 64
  • https://secure-assets.rubiconproject.com/utils/xapi/multi-sync.html?p=adkernel HTTP 301
  • https://eus.rubiconproject.com/usync.html?p=adkernel
Request Chain 66
  • https://pixel-sync.sitescout.com/dmp/pixelSync?nid=49&redir=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D%7BuserId%7D%26dc%3D0abbcb4eba840e59%26fi%3Dea0631bf693866ce HTTP 302
  • https://sync.e-planning.net/um?uid=3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553&dc=0abbcb4eba840e59&iss=1
Request Chain 67
  • https://bh.contextweb.com/bh/rtset?pid=562965&ev=1&us_privacy=${us_privacy}&rurl=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D%%VGUID%%%26dc%3D66b7ef4184d94c10%26fi%3Dea0631bf693866ce HTTP 302
  • https://u-iad04.e-planning.net/um?uid=rANRdsjgURNt&dc=66b7ef4184d94c10&fi=ea0631bf693866ce&ev=1&us_privacy=${us_privacy}&pid=562965
Request Chain 70
  • https://rtb.openx.net/sync/prebid?r=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3Dff96d1aa62deeebd%26fi%3Dea0631bf693866ce%26uid%3D%24%7BUID%7D HTTP 302
  • https://u-iad04.e-planning.net/um?dc=ff96d1aa62deeebd&fi=ea0631bf693866ce&uid=f2b461ff-fb7e-412b-94b2-7e89668d3fb5
Request Chain 72
  • https://prebid-match.dotomi.com/match/bounce/current?networkId=72582&version=1&rurl=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3Dfbb23d0ef33aad5d%26fi%3Dea0631bf693866ce%26uid%3D HTTP 302
  • https://prebid-match.dotomi.com/match/bounce/current?DotomiTest=3ee364016dd91468&is_secure=true&networkId=72582&version=1&rurl=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3Dfbb23d0ef33aad5d%26fi%3Dea0631bf693866ce%26uid%3D HTTP 302
  • https://u-iad04.e-planning.net/um?dc=fbb23d0ef33aad5d&fi=ea0631bf693866ce&uid=AAAHmMgtSjJOcgND081RAAAAAAA&expiration=1708629718
Request Chain 73
  • https://sync.richaudience.com/f7872c90c5d3791e2b51f7edce1a0a5d/?p=25BiP9IMgN&r=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D[PDID]%26dc%3Dfabfd6762b833237%26fi%3Dea0631bf693866ce HTTP 302
  • https://sync.richaudience.com/f7872c90c5d3791e2b51f7edce1a0a5d/?p=25BiP9IMgN&r=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D[PDID]%26dc%3Dfabfd6762b833237%26fi%3Dea0631bf693866ce&rd=1 HTTP 302
  • https://u-iad04.e-planning.net/um?uid=deb741aa-2f28-4634-8160-1zz1708543296&dc=fabfd6762b833237&fi=ea0631bf693866ce
Request Chain 74
  • https://ib.adnxs.com/getuid?https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3D8103fa85295fbe60%26fi%3Dea0631bf693866ce%26uid%3D%24UID HTTP 302
  • https://u-iad04.e-planning.net/um?dc=8103fa85295fbe60&fi=ea0631bf693866ce&uid=3070257596522025748
Request Chain 75
  • https://sync.go.sonobi.com/us?loc=%0A%0Ahttps%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3De52415579699e09f%26fi%3Dea0631bf693866ce%26uid%3D%5BUID%5D HTTP 302
  • https://u-iad04.e-planning.net/um?dc=e52415579699e09f&fi=ea0631bf693866ce&uid=8735f714-7c55-4ddf-b4aa-f391ce20c51c
Request Chain 76
  • https://rtb.om-meta.com/csync?exchange=41cd7873289762a3cc93a994250371cf1cd20569&rurl=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3Dbe1f3f8d2283c058%26fi%3Dea0631bf693866ce%26uid%3D HTTP 302
  • https://u-iad04.e-planning.net/um?dc=be1f3f8d2283c058&fi=ea0631bf693866ce&uid=e61d01e1-01f4-4529-9149-29c5971b856a
Request Chain 77
  • https://ssp.disqus.com/redirectuser?r=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3De64f73568d2b3c34%26fi%3Dea0631bf693866ce%26uid%3D%24UID&partner=eplanning HTTP 302
  • https://prebid.a-mo.net/cchain/0?gdpr=0&gdpr_consent=&us_privacy=&cb=https%3A%2F%2Fssp.disqus.com%2Fmatch%3Fbidder%3D6%26r%3DCid1YS02ODc2NTkyNC1lYzgzLTM3M2QtYTE5Ni0yZTNjNmFiNjBkZjUqdWh0dHBzOi8vdS1pYWQwNC5lLXBsYW5uaW5nLm5ldC91bT9kYz1lNjRmNzM1NjhkMmIzYzM0JmZpPWVhMDYzMWJmNjkzODY2Y2UmdWlkPXVhLTY4NzY1OTI0LWVjODMtMzczZC1hMTk2LTJlM2M2YWI2MGRmNTICBiE4AQ==%26buyeruid%3D HTTP 302
  • https://ib.adnxs.com/getuid?https%3A%2F%2Fprebid.a-mo.net%2Fcchain%2F0%2F19521%3Fgpp%3D%26gdpr_consent%3D%26gdpr%3D0%26gpp_sid%3D%26us_privacy%3D%26A%3D7282b49f-420c-476d-9163-650901d06af2%26bidder%3Dappnexus%26cbx%3DaHR0cHM6Ly9zc3AuZGlzcXVzLmNvbS9tYXRjaD9iaWRkZXI9NiZyPUNpZDFZUzAyT0RjMk5Ua3lOQzFsWXpnekxUTTNNMlF0WVRFNU5pMHlaVE5qTm1GaU5qQmtaalVxZFdoMGRIQnpPaTh2ZFMxcFlXUXdOQzVsTFhCc1lXNXVhVzVuTG01bGRDOTFiVDlrWXoxbE5qUm1Oek0xTmpoa01tSXpZek0wSm1acFBXVmhNRFl6TVdKbU5qa3pPRFkyWTJVbWRXbGtQWFZoTFRZNE56WTFPVEkwTFdWak9ETXRNemN6WkMxaE1UazJMVEpsTTJNMllXSTJNR1JtTlRJQ0JpRTRBUT09JmJ1eWVydWlkPQ%253D%253D%26uid%3D%24UID HTTP 302
  • https://prebid.a-mo.net/cchain/0/19521?gpp=&gdpr_consent=&gdpr=0&gpp_sid=&us_privacy=&A=7282b49f-420c-476d-9163-650901d06af2&bidder=appnexus&cbx=aHR0cHM6Ly9zc3AuZGlzcXVzLmNvbS9tYXRjaD9iaWRkZXI9NiZyPUNpZDFZUzAyT0RjMk5Ua3lOQzFsWXpnekxUTTNNMlF0WVRFNU5pMHlaVE5qTm1GaU5qQmtaalVxZFdoMGRIQnpPaTh2ZFMxcFlXUXdOQzVsTFhCc1lXNXVhVzVuTG01bGRDOTFiVDlrWXoxbE5qUm1Oek0xTmpoa01tSXpZek0wSm1acFBXVmhNRFl6TVdKbU5qa3pPRFkyWTJVbWRXbGtQWFZoTFRZNE56WTFPVEkwTFdWak9ETXRNemN6WkMxaE1UazJMVEpsTTJNMllXSTJNR1JtTlRJQ0JpRTRBUT09JmJ1eWVydWlkPQ%3D%3D&uid=3070257596522025748 HTTP 302
  • https://id.a-mx.com/u?&gdpr=0&us_privacy=1---&cb=https%3A%2F%2Fprebid.a-mo.net%2Fcchain%2F1%2F19521%3Fgpp%3D%26gdpr_consent%3D%26gdpr%3D0%26gpp_sid%3D%26us_privacy%3D%26A%3D7282b49f-420c-476d-9163-650901d06af2%26bidder%3Damx_com%26cbx%3DaHR0cHM6Ly9zc3AuZGlzcXVzLmNvbS9tYXRjaD9iaWRkZXI9NiZyPUNpZDFZUzAyT0RjMk5Ua3lOQzFsWXpnekxUTTNNMlF0WVRFNU5pMHlaVE5qTm1GaU5qQmtaalVxZFdoMGRIQnpPaTh2ZFMxcFlXUXdOQzVsTFhCc1lXNXVhVzVuTG01bGRDOTFiVDlrWXoxbE5qUm1Oek0xTmpoa01tSXpZek0wSm1acFBXVmhNRFl6TVdKbU5qa3pPRFkyWTJVbWRXbGtQWFZoTFRZNE56WTFPVEkwTFdWak9ETXRNemN6WkMxaE1UazJMVEpsTTJNMllXSTJNR1JtTlRJQ0JpRTRBUT09JmJ1eWVydWlkPQ%253D%253D%26uid%3D HTTP 302
  • https://prebid.a-mo.net/cchain/1/19521?gpp=&gdpr_consent=&gdpr=0&gpp_sid=&us_privacy=&A=7282b49f-420c-476d-9163-650901d06af2&bidder=amx_com&cbx=aHR0cHM6Ly9zc3AuZGlzcXVzLmNvbS9tYXRjaD9iaWRkZXI9NiZyPUNpZDFZUzAyT0RjMk5Ua3lOQzFsWXpnekxUTTNNMlF0WVRFNU5pMHlaVE5qTm1GaU5qQmtaalVxZFdoMGRIQnpPaTh2ZFMxcFlXUXdOQzVsTFhCc1lXNXVhVzVuTG01bGRDOTFiVDlrWXoxbE5qUm1Oek0xTmpoa01tSXpZek0wSm1acFBXVmhNRFl6TVdKbU5qa3pPRFkyWTJVbWRXbGtQWFZoTFRZNE56WTFPVEkwTFdWak9ETXRNemN6WkMxaE1UazJMVEpsTTJNMllXSTJNR1JtTlRJQ0JpRTRBUT09JmJ1eWVydWlkPQ%3D%3D&uid=7282b49f-420c-476d-9163-650901d06af2 HTTP 302
  • https://ssum.casalemedia.com/usermatchredir?s=191503&gdpr=0&us_privacy=1---&cb=https%3A%2F%2Fprebid.a-mo.net%2Fcchain%2F4%2F19521%3Fgpp%3D%26gdpr_consent%3D%26gdpr%3D0%26gpp_sid%3D%26us_privacy%3D%26A%3D7282b49f-420c-476d-9163-650901d06af2%26bidder%3Dindex_rtb%26cbx%3DaHR0cHM6Ly9zc3AuZGlzcXVzLmNvbS9tYXRjaD9iaWRkZXI9NiZyPUNpZDFZUzAyT0RjMk5Ua3lOQzFsWXpnekxUTTNNMlF0WVRFNU5pMHlaVE5qTm1GaU5qQmtaalVxZFdoMGRIQnpPaTh2ZFMxcFlXUXdOQzVsTFhCc1lXNXVhVzVuTG01bGRDOTFiVDlrWXoxbE5qUm1Oek0xTmpoa01tSXpZek0wSm1acFBXVmhNRFl6TVdKbU5qa3pPRFkyWTJVbWRXbGtQWFZoTFRZNE56WTFPVEkwTFdWak9ETXRNemN6WkMxaE1UazJMVEpsTTJNMllXSTJNR1JtTlRJQ0JpRTRBUT09JmJ1eWVydWlkPQ%253D%253D%26uid%3D HTTP 302
  • https://prebid.a-mo.net/cchain/4/19521?us_privacy=1---&gpp=&gdpr_consent=&gdpr=0&gpp_sid=&us_privacy=&A=7282b49f-420c-476d-9163-650901d06af2&bidder=index_rtb&cbx=aHR0cHM6Ly9zc3AuZGlzcXVzLmNvbS9tYXRjaD9iaWRkZXI9NiZyPUNpZDFZUzAyT0RjMk5Ua3lOQzFsWXpnekxUTTNNMlF0WVRFNU5pMHlaVE5qTm1GaU5qQmtaalVxZFdoMGRIQnpPaTh2ZFMxcFlXUXdOQzVsTFhCc1lXNXVhVzVuTG01bGRDOTFiVDlrWXoxbE5qUm1Oek0xTmpoa01tSXpZek0wSm1acFBXVmhNRFl6TVdKbU5qa3pPRFkyWTJVbWRXbGtQWFZoTFRZNE56WTFPVEkwTFdWak9ETXRNemN6WkMxaE1UazJMVEpsTTJNMllXSTJNR1JtTlRJQ0JpRTRBUT09JmJ1eWVydWlkPQ%3D%3D&uid=ZdZNVdHM4ZgAAAdJAE2s5QAA%262470 HTTP 302
  • https://rtb.openx.net/sync/prebid?&gdpr=0&us_privacy=1---&r=https%3A%2F%2Fprebid.a-mo.net%2Fcchain%2F6%2F19521%3Fgpp%3D%26gdpr_consent%3D%26gdpr%3D0%26gpp_sid%3D%26us_privacy%3D%26A%3D7282b49f-420c-476d-9163-650901d06af2%26bidder%3Dopenx%26cbx%3DaHR0cHM6Ly9zc3AuZGlzcXVzLmNvbS9tYXRjaD9iaWRkZXI9NiZyPUNpZDFZUzAyT0RjMk5Ua3lOQzFsWXpnekxUTTNNMlF0WVRFNU5pMHlaVE5qTm1GaU5qQmtaalVxZFdoMGRIQnpPaTh2ZFMxcFlXUXdOQzVsTFhCc1lXNXVhVzVuTG01bGRDOTFiVDlrWXoxbE5qUm1Oek0xTmpoa01tSXpZek0wSm1acFBXVmhNRFl6TVdKbU5qa3pPRFkyWTJVbWRXbGtQWFZoTFRZNE56WTFPVEkwTFdWak9ETXRNemN6WkMxaE1UazJMVEpsTTJNMllXSTJNR1JtTlRJQ0JpRTRBUT09JmJ1eWVydWlkPQ%253D%253D%26uid%3D%24%7BUID%7D HTTP 302
  • https://prebid.a-mo.net/cchain/6/19521?gpp=&gdpr_consent=&gdpr=0&gpp_sid=&us_privacy=&A=7282b49f-420c-476d-9163-650901d06af2&bidder=openx&cbx=aHR0cHM6Ly9zc3AuZGlzcXVzLmNvbS9tYXRjaD9iaWRkZXI9NiZyPUNpZDFZUzAyT0RjMk5Ua3lOQzFsWXpnekxUTTNNMlF0WVRFNU5pMHlaVE5qTm1GaU5qQmtaalVxZFdoMGRIQnpPaTh2ZFMxcFlXUXdOQzVsTFhCc1lXNXVhVzVuTG01bGRDOTFiVDlrWXoxbE5qUm1Oek0xTmpoa01tSXpZek0wSm1acFBXVmhNRFl6TVdKbU5qa3pPRFkyWTJVbWRXbGtQWFZoTFRZNE56WTFPVEkwTFdWak9ETXRNemN6WkMxaE1UazJMVEpsTTJNMllXSTJNR1JtTlRJQ0JpRTRBUT09JmJ1eWVydWlkPQ%3D%3D&uid=f2b461ff-fb7e-412b-94b2-7e89668d3fb5 HTTP 302
  • https://ssp.disqus.com/match?bidder=6&r=Cid1YS02ODc2NTkyNC1lYzgzLTM3M2QtYTE5Ni0yZTNjNmFiNjBkZjUqdWh0dHBzOi8vdS1pYWQwNC5lLXBsYW5uaW5nLm5ldC91bT9kYz1lNjRmNzM1NjhkMmIzYzM0JmZpPWVhMDYzMWJmNjkzODY2Y2UmdWlkPXVhLTY4NzY1OTI0LWVjODMtMzczZC1hMTk2LTJlM2M2YWI2MGRmNTICBiE4AQ==&buyeruid=7282b49f-420c-476d-9163-650901d06af2&gdpr=0 HTTP 302
  • https://b1sync.zemanta.com/usersync/disqus?puid=ua-68765924-ec83-373d-a196-2e3c6ab60df5&gdpr=0&gdpr_consent=&us_privacy=&cb=https%3A%2F%2Fssp.disqus.com%2Fmatch%3Fbidder%3D33%26buyeruid%3D__ZUID__%26r%3DCid1YS02ODc2NTkyNC1lYzgzLTM3M2QtYTE5Ni0yZTNjNmFiNjBkZjUqdWh0dHBzOi8vdS1pYWQwNC5lLXBsYW5uaW5nLm5ldC91bT9kYz1lNjRmNzM1NjhkMmIzYzM0JmZpPWVhMDYzMWJmNjkzODY2Y2UmdWlkPXVhLTY4NzY1OTI0LWVjODMtMzczZC1hMTk2LTJlM2M2YWI2MGRmNTICBiE4Ag==
Request Chain 78
  • https://match.sharethrough.com/universal/v1?supply_id=H7IJBRjH HTTP 302
  • https://sync.e-planning.net/um?uid=b3cbfa3d-f13e-4b97-85b4-bce66903b033&dc=769fefa8321c94fb&iss=1
Request Chain 79
  • https://cookies.nextmillmedia.com/sync?type=image&gdpr={{.GDPR}}&gdpr_consent={{.GDPRConsent}}&us_privacy={{.USPrivacy}}&redirect=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D%5BNMUID%5D%26dc%3Db337141cfdc8cf59%26fi%3Dea0631bf693866ce HTTP 302
  • https://u-iad04.e-planning.net/um?uid=csuid_e4506247-da99-4ad4-9edf-b8e567251462&dc=b337141cfdc8cf59&fi=ea0631bf693866ce
Request Chain 81
  • https://x.bidswitch.net/sync?ssp=eplanning HTTP 302
  • https://a.sportradarserving.com/sync?ssp=bidswitch&bidswitch_ssp_id=eplanning HTTP 302
  • https://a.sportradarserving.com/ul_cb/sync?ssp=bidswitch&bidswitch_ssp_id=eplanning HTTP 302
  • https://x.bidswitch.net/sync?dsp_id=409&expires=14&user_group=1&user_id=ce4be3d1-15dd-4019-ab01-cc272e5399e5&ssp=eplanning
Request Chain 82
  • https://cm-x.mgid.com/7c66bfc34cae8636a9aefaf68cb9041c.gif?redir=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D%5BUID%5D%26dc%3D98bd04598763300f%26fi%3Dea0631bf693866ce HTTP 302
  • https://u-iad04.e-planning.net/um?uid=f8e3f8cf-7d31-4baf-993e-93ec498f54d9&dc=98bd04598763300f&fi=ea0631bf693866ce
Request Chain 83
  • https://gw-iad-bid.ymmobi.com/adx/user/sync?pubid=ZXBsYW5uaW5n&gdpr=${GDPR}&gdpr_consent=${GDPR_CONSENT}&us_privacy=${US_PRIVACY}&callback=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D%7Bym_user_id%7D%26dc%3Ddbfd729d40c9c3fc%26fi%3Dea0631bf693866ce HTTP 302
  • https://u-iad04.e-planning.net/um?uid=ym_user_fd793f8a-22aa-4deb-bed6-b4a4ada902df&dc=dbfd729d40c9c3fc&fi=ea0631bf693866ce
Request Chain 84
  • https://sync.1rx.io/usersync2/rmpssp?sub=eplanning HTTP 302
  • https://ad.turn.com/r/cs?pid=45&rndcb=96889016 HTTP 302
  • https://sync.1rx.io/usersync/turn/2485436676656858684?dspret=1&gdpr=&gdpr_consent=&us_privacy= HTTP 302
  • https://sync.targeting.unrulymedia.com/csync/RX-704c440e-c06a-4152-9309-008e3de3e6e8-005?redir=https%3A%2F%2Fsync.e-planning.net%2Fum%3Fuid%3DRX-704c440e-c06a-4152-9309-008e3de3e6e8-005%26dc%3Dfc741bbdfeedcd57%26iss%3D1 HTTP 302
  • https://sync.e-planning.net/um?uid=RX-704c440e-c06a-4152-9309-008e3de3e6e8-005&dc=fc741bbdfeedcd57&iss=1
Request Chain 85
  • https://rtb.mfadsrvr.com/sync?ssp=onetag&ssp_user_id=3PobiDqnnW2DwaFlGOAQZdyB3CiR7dkOFHWmEpuT8GQ HTTP 302
  • https://rtb.mfadsrvr.com/ul_cb/sync?ssp=onetag&ssp_user_id=3PobiDqnnW2DwaFlGOAQZdyB3CiR7dkOFHWmEpuT8GQ HTTP 302
  • https://onetag-sys.com/match/?int_id=160&uid=9fb2006b-9167-48df-b1b8-da147b8d8502
Request Chain 86
  • https://sync.mathtag.com/sync/img?mt_exid=75&redir=https%3A%2F%2Fonetag-sys.com%2Fmatch%2F%3Fint_id%3D1%26uid%3D%5BMM_UUID%5D%26gdpr%3D1%26gdpr_consent%3D HTTP 302
  • https://onetag-sys.com/match/?int_id=1&uid=7d3865d6-4d56-4600-8c23-a9a5b19c894d&gdpr=1&gdpr_consent=
Request Chain 88
  • https://ib.adnxs.com/getuid?https%3A%2F%2Fonetag-sys.com%2Fmatch%2F%3Fint_id%3D98%26gdpr%3D1%26gdpr_consent%3D%26uid%3D$UID HTTP 302
  • https://onetag-sys.com/match/?int_id=98&gdpr=1&gdpr_consent=&uid=3070257596522025748
Request Chain 89
  • https://ads.stickyadstv.com/user-matching?id=3679&gdpr=1&gdpr_consent= HTTP 302
  • https://onetag-sys.com/match/?int_id=3&uid=fa139982685bb63bf3f437124cf5a4f&gdpr_consent=&gdpr=1
Request Chain 91
  • https://cs.admanmedia.com/73c1e1bfc3bde354d60b80e601ae3914.gif?puid=[UID]&redir=https%3A%2F%2Fonetag-sys.com%2Fmatch%2F%3Fint_id%3D164%26gdpr%3D%24%7BGDPR%7D%26gdpr_consent%3D%24%7BGDPR_STRING%7D%26uid%3D%5BUID%5D&gdpr=1&gdpr_consent=&ccpa=&coppa= HTTP 302
  • https://onetag-sys.com/match/?int_id=164&gdpr=${GDPR}&gdpr_consent=${GDPR_STRING}&uid=561a92ff-346c-476f-adac-bcabc4257400
Request Chain 92
  • https://t.adx.opera.com/pub/sync?pubid=pub10101531197440 HTTP 302
  • https://onetag-sys.com/match/?gdpr=&gdpr_consent=%24%7BGDPR_STRING%7D&int_id=168&uid=OPU1ecaf7e16f974ca1a3d2add4085f996f
Request Chain 93
  • https://onetag-sys.com/match/?int_id=106&redir=1&ot_initiated=1 HTTP 302
  • https://cm.g.doubleclick.net/pixel?google_nid=one_tag&google_hm=AAABjc0eGwo2FQo3lIZx6VrFHMkUyhZ8zH6cVQ
Request Chain 95
  • https://onetag-sys.com/match/?int_id=113&gdpr=1&gdpr_consent=&callback=https%3A%2F%2Fs.amazon-adsystem.com%2Fecm3%3Fex%3Donetag.com%26id%3D%24%7BUSER_TOKEN%7D&ot_initiated=1 HTTP 302
  • https://s.amazon-adsystem.com/ecm3?ex=onetag.com&id=WKzGpuhSpd1jsBev_HtKL7tG8E4XNK7rzd579tKbaIU
Request Chain 97
  • https://cm.g.doubleclick.net/pixel?google_nid=onetag_eb&google_cm HTTP 302
  • https://onetag-sys.com/match/?int_id=106&google_error=15
Request Chain 98
  • https://bh.contextweb.com/bh/rtset?pid=562985&ev=1&us_privacy=&rurl=https%3A%2F%2Fonetag-sys.com%2Fmatch%2F%3Fint_id%3D149%26gdpr%3D%24%7BGDPR%7D%26gdpr_consent%3D%24%7BGDPR_STRING%7D%26uid%3D%25%25VGUID%25%25 HTTP 302
  • https://onetag-sys.com/match/?int_id=149&gdpr=${GDPR}&gdpr_consent=${GDPR_STRING}&uid=rANRdsjgURNt&ev=1&us_privacy=&pid=562985
Request Chain 99
  • https://prebid-match.dotomi.com/match/bounce/current?version=1&networkId=72582&rurl=https%3A%2F%2Fonetag-sys.com%2Fmatch%2F%3Fint_id%3D90%26gdpr%3D0%26gdpr_consent%3D%26uid%3D HTTP 302
  • https://prebid-match.dotomi.com/match/bounce/current?DotomiTest=73907419df421181&is_secure=true&version=1&networkId=72582&rurl=https%3A%2F%2Fonetag-sys.com%2Fmatch%2F%3Fint_id%3D90%26gdpr%3D0%26gdpr_consent%3D%26uid%3D HTTP 302
  • https://onetag-sys.com/match/?int_id=90&gdpr=0&gdpr_consent=&uid=AAAHP_bPND0F-QNJ-xfQAAAAAAA&expiration=1708629718
Request Chain 101
  • https://match.adsrvr.org/track/cmf/generic?ttd_pid=vw6iyrn&ttd_tpi=1&gpdr=1&gdpr_consent= HTTP 302
  • https://match.adsrvr.org/track/cmb/generic?ttd_pid=vw6iyrn&ttd_tpi=1&gpdr=1&gdpr_consent= HTTP 302
  • https://onetag-sys.com/match/?int_id=29&uid=ade1d398-3078-4488-aa7b-1c669b6286de&gdpr=0&gdpr_consent=
Request Chain 104
  • https://secure-assets.rubiconproject.com/utils/xapi/multi-sync.html?&p=eplanning_east&endpoint=us-east HTTP 301
  • https://eus.rubiconproject.com/usync.html?&p=eplanning_east&endpoint=us-east
Request Chain 108
  • https://api.retargetly.com/api?id=1473&src=0&url=https%3A%2F%2Fads.us.e-planning.net%2Fuspd%2F1%2F29f836b1c2dd7f7b%3Fct%3D1%26ruidm%3D1%26du%3D%2F%2Fsync.adkernel.com%2Fuser-sync%3Fzone%3D181225%26dsp%3D629319%26t%3Diframe%26uid%3D%24uid%26gdpr%3D1%26gdpr_consent%3Dcp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa%26us_privacy%3D1---&browserUrl=https%3A%2F%2Fads.us.e-planning.net%2Fuspd%2F1%2F29f836b1c2dd7f7b%3Fct%3D1%26ruidm%3D1%26du%3D%2F%2Fsync.adkernel.com%2Fuser-sync%3Fzone%3D181225%26dsp%3D629319%26t%3Diframe%26uid%3D%24uid%26gdpr%3D1%26gdpr_consent%3Dcp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa%26us_privacy%3D1---&ref=&utmz=&n=&md=&mk=&il=0&limit_drop=&userid=4a23b8ef-e0b1-4e48-8a8e-0462f462fd31&fullVersionList=&platform= HTTP 302
  • https://api.retargetly.com/api?id=1473&src=0&url=https%3A%2F%2Fads.us.e-planning.net%2Fuspd%2F1%2F29f836b1c2dd7f7b%3Fct%3D1%26ruidm%3D1%26du%3D%2F%2Fsync.adkernel.com%2Fuser-sync%3Fzone%3D181225%26dsp%3D629319%26t%3Diframe%26uid%3D%24uid%26gdpr%3D1%26gdpr_consent%3Dcp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa%26us_privacy%3D1---&browserUrl=https%3A%2F%2Fads.us.e-planning.net%2Fuspd%2F1%2F29f836b1c2dd7f7b%3Fct%3D1%26ruidm%3D1%26du%3D%2F%2Fsync.adkernel.com%2Fuser-sync%3Fzone%3D181225%26dsp%3D629319%26t%3Diframe%26uid%3D%24uid%26gdpr%3D1%26gdpr_consent%3Dcp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa%26us_privacy%3D1---&ref=&utmz=&n=&md=&mk=&il=0&limit_drop=&userid=4a23b8ef-e0b1-4e48-8a8e-0462f462fd31&fullVersionList=&platform=&_rlid=4a23b8ef-e0b1-4e48-8a8e-0462f462fd31
Request Chain 110
  • https://dsum-sec.casalemedia.com/rrum?ixi=1&cm_dsp_id=85&cb=https%3A%2F%2Fcm.g.doubleclick.net%2Fpixel%3Fgoogle_nid%3Dcasale_media2_dbm%26google_cm%26google_sc%26google_hm%3D HTTP 302
  • https://cm.g.doubleclick.net/pixel?google_nid=casale_media2_dbm&google_cm&google_sc&google_hm=ZdZNVdHM4ZgAAAdJAE2s5QAA
Request Chain 111
  • https://secure.adnxs.com/getuid?https://dsum-sec.casalemedia.com/crum?cm_dsp_id=46&external_user_id=$UID HTTP 302
  • https://dsum-sec.casalemedia.com/crum?cm_dsp_id=46&external_user_id=3070257596522025748
Request Chain 114
  • https://s.company-target.com/s/ix?cm_dsp_id=18&us_privacy=&gdpr=&gdpr_consent=&gpp=&gpp_sid= HTTP 302
  • https://dsum-sec.casalemedia.com/crum?cm_dsp_id=18&expiration=1724268119&external_user_id=a5c46844-fc41-4b35-ae6e-4b4fa313a19e
Request Chain 115
  • https://dpm.demdex.net/ibs:dpid=23728&dpuuid=ZdZNVdHM4ZgAAAdJAE2s5QAA%262470?gdpr_consent=&us_privacy=&gdpr=&gpp=&gpp_sid= HTTP 302
  • https://dpm.demdex.net/demconf.jpg?et:ibs%7cdata:dpid=23728&dpuuid=ZdZNVdHM4ZgAAAdJAE2s5QAA%262470
Request Chain 119
  • https://pdp-service.retargetly.com/event_collector_cookies HTTP 307
  • https://pdp-service.retargetly.com/event_collector_cookies?redirect=true
Request Chain 123
  • https://eb2.3lift.com/sync?redir=https%3A%2F%2Fsync.e-planning.net%2Fum%3Fuid%3D%24UID%26dc%3D4d76b6ce34af74c9%26iss%3D1 HTTP 302
  • https://eb2.3lift.com/sync?redir=https%3A%2F%2Fsync.e-planning.net%2Fum%3Fuid%3D%24UID%26dc%3D4d76b6ce34af74c9%26iss%3D1&ld=1
Request Chain 127
  • https://match.adsrvr.org/track/cmf/generic?ttd_pid=83i98y4&ttd_tpi=1 HTTP 302
  • https://api.retargetly.com/sync?pid=13&sid=6ac759cd-581b-4dc6-abe7-46b63a59a046
Request Chain 128
  • https://retargetly-match.dotomi.com/match/bounce/current?networkId=95012&version=1&nuid=4a23b8ef-e0b1-4e48-8a8e-0462f462fd31 HTTP 302
  • https://retargetly-match.dotomi.com/match/bounce/current?DotomiTest=68ff78b9cbf1562&is_secure=true&networkId=95012&version=1&nuid=4a23b8ef-e0b1-4e48-8a8e-0462f462fd31 HTTP 302
  • https://app.retargetly.com/sync?pid=72&sid=AAAHmMgtSjJOjAMCqwroAAAAAAA&expiration=1708629719&nuid=4a23b8ef-e0b1-4e48-8a8e-0462f462fd31&is_secure=true
Request Chain 129
  • https://pixel.tapad.com/idsync/ex/receive?partner_id=3012&partner_device_id=4a23b8ef-e0b1-4e48-8a8e-0462f462fd31&_rand=1708543319026 HTTP 302
  • https://pixel.tapad.com/idsync/ex/receive/check?partner_id=3012&partner_device_id=4a23b8ef-e0b1-4e48-8a8e-0462f462fd31&_rand=1708543319026 HTTP 302
  • https://match.adsrvr.org/track/cmf/generic?ttd_pid=tapad&ttd_tpi=1&ttd_puid=c43dfc6b-74d9-4c90-9ffb-a47ab816a7cb%252C%252C&gdpr=0&gdpr_consent= HTTP 302
  • https://pixel.tapad.com/idsync/ex/receive?partner_id=1830&partner_device_id=6ac759cd-581b-4dc6-abe7-46b63a59a046&ttd_puid=c43dfc6b-74d9-4c90-9ffb-a47ab816a7cb%2C%2C
Request Chain 130
  • https://cm.g.doubleclick.net/pixel?google_nid=retargetly_ddp&google_hm=NGEyM2I4ZWYtZTBiMS00ZTQ4LThhOGUtMDQ2MmY0NjJmZDMx&google_cm HTTP 302
  • https://app.retargetly.com/sync?pid=11&google_error=15
Request Chain 131
  • https://secure.adnxs.com/getuid?https://app.retargetly.com/sync?sid=$UID&pid=2 HTTP 302
  • https://app.retargetly.com/sync?sid=3070257596522025748&pid=2
Request Chain 132
  • https://cms.analytics.yahoo.com/cms?partner_id=RTGLY HTTP 302
  • https://ups.analytics.yahoo.com/ups/58698/cms?partner_id=RTGLY HTTP 302
  • https://app.retargetly.com/sync?pid=22&sid=y-Fu8DgZ5E2oL5zgUi1gaofOHs1Bo6YtW4ZdA-~A
Request Chain 133
  • https://pixel-sync.sitescout.com/connectors/retargetly/usersync?redir=https%3A%2F%2Fapp.retargetly.com%2Fsync%3Fsid%3D%7BuserId%7D%26pid%3D23 HTTP 302
  • https://app.retargetly.com/sync?sid=3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553&pid=23
Request Chain 136
  • https://sync.smartadserver.com/getuid?gdpr=0&url=https%3A%2F%2Fapp.retargetly.com%2Fsync%3Fpid%3D74%26sid%3D%5Bsas_uid%5D HTTP 302
  • https://sync.smartadserver.com/getuid?gdpr=0&url=https://app.retargetly.com/sync?pid=74&sid=[sas_uid]&cklb=1
Request Chain 138
  • https://ads.stickyadstv.com/user-matching?id=3679&gdpr=1&gdpr_consent= HTTP 302
  • https://onetag-sys.com/match/?int_id=3&uid=e8bd5d74efbcae93c13977f76e5feae&gdpr_consent=&gdpr=1
Request Chain 139
  • https://cs.admanmedia.com/73c1e1bfc3bde354d60b80e601ae3914.gif?puid=[UID]&redir=https%3A%2F%2Fonetag-sys.com%2Fmatch%2F%3Fint_id%3D164%26gdpr%3D%24%7BGDPR%7D%26gdpr_consent%3D%24%7BGDPR_STRING%7D%26uid%3D%5BUID%5D&gdpr=1&gdpr_consent=&ccpa=&coppa= HTTP 302
  • https://onetag-sys.com/match/?int_id=164&gdpr=${GDPR}&gdpr_consent=${GDPR_STRING}&uid=db308ea2-626b-4945-b685-2a60982c63dd
Request Chain 140
  • https://t.adx.opera.com/pub/sync?pubid=pub10101531197440 HTTP 302
  • https://onetag-sys.com/match/?gdpr=&gdpr_consent=%24%7BGDPR_STRING%7D&int_id=168&uid=OPUbb4f614db20440d58e97e1afa7d8a614
Request Chain 141
  • https://onetag-sys.com/match/?int_id=106&redir=1&ot_initiated=1 HTTP 302
  • https://cm.g.doubleclick.net/pixel?google_nid=one_tag&google_hm=AAABjc0eHMGSe8YMdpVIHixaCh28FZAzr6LyvA
Request Chain 143
  • https://onetag-sys.com/match/?int_id=113&gdpr=1&gdpr_consent=&callback=https%3A%2F%2Fs.amazon-adsystem.com%2Fecm3%3Fex%3Donetag.com%26id%3D%24%7BUSER_TOKEN%7D&ot_initiated=1 HTTP 302
  • https://s.amazon-adsystem.com/ecm3?ex=onetag.com&id=WKzGpuhSpd1jsBev_HtKL7tG8E4XNK7rzd579tKbaIU
Request Chain 145
  • https://prebid-match.dotomi.com/match/bounce/current?version=1&networkId=72582&rurl=https%3A%2F%2Fonetag-sys.com%2Fmatch%2F%3Fint_id%3D90%26gdpr%3D0%26gdpr_consent%3D%26uid%3D HTTP 302
  • https://prebid-match.dotomi.com/match/bounce/current?DotomiTest=70fe2fd20a851215&is_secure=true&version=1&networkId=72582&rurl=https%3A%2F%2Fonetag-sys.com%2Fmatch%2F%3Fint_id%3D90%26gdpr%3D0%26gdpr_consent%3D%26uid%3D HTTP 302
  • https://onetag-sys.com/match/?int_id=90&gdpr=0&gdpr_consent=&uid=AAAGbJPf5zYNVQNdxtg1AAAAAAA&expiration=1708629719
Request Chain 147
  • https://match.adsrvr.org/track/cmf/generic?ttd_pid=vw6iyrn&ttd_tpi=1&gpdr=1&gdpr_consent= HTTP 302
  • https://onetag-sys.com/match/?int_id=29&uid=6ac759cd-581b-4dc6-abe7-46b63a59a046&gdpr=0&gdpr_consent=
Request Chain 149
  • https://rtb.mfadsrvr.com/sync?ssp=onetag&ssp_user_id=WKzGpuhSpd1jsBev_HtKL7tG8E4XNK7rzd579tKbaIU HTTP 302
  • https://onetag-sys.com/match/?int_id=160&uid=9fb2006b-9167-48df-b1b8-da147b8d8502
Request Chain 150
  • https://sync.mathtag.com/sync/img?mt_exid=75&redir=https%3A%2F%2Fonetag-sys.com%2Fmatch%2F%3Fint_id%3D1%26uid%3D%5BMM_UUID%5D%26gdpr%3D1%26gdpr_consent%3D HTTP 302
  • https://onetag-sys.com/match/?int_id=1&uid=7d3865d6-4d56-4600-8c23-a9a5b19c894d&gdpr=1&gdpr_consent=
Request Chain 151
  • https://ib.adnxs.com/getuid?https%3A%2F%2Fonetag-sys.com%2Fmatch%2F%3Fint_id%3D98%26gdpr%3D1%26gdpr_consent%3D%26uid%3D$UID HTTP 302
  • https://onetag-sys.com/match/?int_id=98&gdpr=1&gdpr_consent=&uid=3070257596522025748
Request Chain 153
  • https://cm.g.doubleclick.net/pixel?google_nid=onetag_eb&google_cm HTTP 302
  • https://onetag-sys.com/match/?int_id=106&google_error=15
Request Chain 154
  • https://bh.contextweb.com/bh/rtset?pid=562985&ev=1&us_privacy=&rurl=https%3A%2F%2Fonetag-sys.com%2Fmatch%2F%3Fint_id%3D149%26gdpr%3D%24%7BGDPR%7D%26gdpr_consent%3D%24%7BGDPR_STRING%7D%26uid%3D%25%25VGUID%25%25 HTTP 302
  • https://onetag-sys.com/match/?int_id=149&gdpr=${GDPR}&gdpr_consent=${GDPR_STRING}&uid=rANRdsjgURNt&ev=1&us_privacy=&pid=562985
Request Chain 158
  • https://prebid.a-mo.net/cchain/0?&cb=%2F%2Fsync.adkernel.com%2Fuser-sync%3Fzone%3D202990%26dsp%3D343983%26t%3Dimage%26uid%3D HTTP 302
  • https://ib.adnxs.com/getuid?https%3A%2F%2Fprebid.a-mo.net%2Fcchain%2F0%2F30083%3Fgpp%3D%26gdpr_consent%3D%26gdpr%3D%26gpp_sid%3D%26us_privacy%3D%26A%3D212a44e0-7977-42f2-824e-86e1ee2bbeb0%26bidder%3Dappnexus%26cbx%3DLy9zeW5jLmFka2VybmVsLmNvbS91c2VyLXN5bmM_em9uZT0yMDI5OTAmZHNwPTM0Mzk4MyZ0PWltYWdlJnVpZD0%253D%26uid%3D%24UID HTTP 302
  • https://prebid.a-mo.net/cchain/0/30083?gpp=&gdpr_consent=&gdpr=&gpp_sid=&us_privacy=&A=212a44e0-7977-42f2-824e-86e1ee2bbeb0&bidder=appnexus&cbx=Ly9zeW5jLmFka2VybmVsLmNvbS91c2VyLXN5bmM_em9uZT0yMDI5OTAmZHNwPTM0Mzk4MyZ0PWltYWdlJnVpZD0%3D&uid=3070257596522025748 HTTP 302
  • https://id.a-mx.com/u?&gdpr=0&us_privacy=1---&cb=https%3A%2F%2Fprebid.a-mo.net%2Fcchain%2F1%2F30083%3Fgpp%3D%26gdpr_consent%3D%26gdpr%3D%26gpp_sid%3D%26us_privacy%3D%26A%3D212a44e0-7977-42f2-824e-86e1ee2bbeb0%26bidder%3Damx_com%26cbx%3DLy9zeW5jLmFka2VybmVsLmNvbS91c2VyLXN5bmM_em9uZT0yMDI5OTAmZHNwPTM0Mzk4MyZ0PWltYWdlJnVpZD0%253D%26uid%3D HTTP 302
  • https://prebid.a-mo.net/cchain/1/30083?gpp=&gdpr_consent=&gdpr=&gpp_sid=&us_privacy=&A=212a44e0-7977-42f2-824e-86e1ee2bbeb0&bidder=amx_com&cbx=Ly9zeW5jLmFka2VybmVsLmNvbS91c2VyLXN5bmM_em9uZT0yMDI5OTAmZHNwPTM0Mzk4MyZ0PWltYWdlJnVpZD0%3D&uid=212a44e0-7977-42f2-824e-86e1ee2bbeb0 HTTP 302
  • https://image8.pubmatic.com/AdServer/ImgSync?p=158355&gdpr=0&us_privacy=1---&pu=https%3A%2F%2Fimage4.pubmatic.com%2FAdServer%2FSPug%3Fp%3D158355%26pmc%3DPM_PMC%26pr%3Dhttps%253A%252F%252Fprebid.a-mo.net%252Fcchain%252F3%252F30083%253Fgpp%253D%2526gdpr_consent%253D%2526gdpr%253D%2526gpp_sid%253D%2526us_privacy%253D%2526A%253D212a44e0-7977-42f2-824e-86e1ee2bbeb0%2526bidder%253Dpubmatic%2526cbx%253DLy9zeW5jLmFka2VybmVsLmNvbS91c2VyLXN5bmM_em9uZT0yMDI5OTAmZHNwPTM0Mzk4MyZ0PWltYWdlJnVpZD0%25253D%2526uid%253D%2523PMUID HTTP 302
  • https://image4.pubmatic.com/AdServer/SPug?gdpr=0&p=158355&pmc=1&pr=https%3A%2F%2Fprebid.a-mo.net%2Fcchain%2F3%2F30083%3Fgpp%3D%26gdpr_consent%3D%26gdpr%3D%26gpp_sid%3D%26us_privacy%3D%26A%3D212a44e0-7977-42f2-824e-86e1ee2bbeb0%26bidder%3Dpubmatic%26cbx%3DLy9zeW5jLmFka2VybmVsLmNvbS91c2VyLXN5bmM_em9uZT0yMDI5OTAmZHNwPTM0Mzk4MyZ0PWltYWdlJnVpZD0%253D%26uid%3DCBF00FF6-FEA1-42AB-B113-53FFB027089E&us_privacy=1--- HTTP 302
  • https://prebid.a-mo.net/cchain/3/30083?gpp=&gdpr_consent=&gdpr=&gpp_sid=&us_privacy=&A=212a44e0-7977-42f2-824e-86e1ee2bbeb0&bidder=pubmatic&cbx=Ly9zeW5jLmFka2VybmVsLmNvbS91c2VyLXN5bmM_em9uZT0yMDI5OTAmZHNwPTM0Mzk4MyZ0PWltYWdlJnVpZD0%3D&uid=CBF00FF6-FEA1-42AB-B113-53FFB027089E HTTP 302
  • https://ap.lijit.com/pixel?&gdpr=0&us_privacy=1---&redir=https%3A%2F%2Fprebid.a-mo.net%2Fcchain%2F4%2F30083%3Fgpp%3D%26gdpr_consent%3D%26gdpr%3D%26gpp_sid%3D%26us_privacy%3D%26A%3D212a44e0-7977-42f2-824e-86e1ee2bbeb0%26bidder%3Dsovrn%26cbx%3DLy9zeW5jLmFka2VybmVsLmNvbS91c2VyLXN5bmM_em9uZT0yMDI5OTAmZHNwPTM0Mzk4MyZ0PWltYWdlJnVpZD0%253D%26uid%3D%24UID HTTP 307
  • https://prebid.a-mo.net/cchain/4/30083?gpp=&gdpr_consent=&gdpr=&gpp_sid=&us_privacy=&A=212a44e0-7977-42f2-824e-86e1ee2bbeb0&bidder=sovrn&cbx=Ly9zeW5jLmFka2VybmVsLmNvbS91c2VyLXN5bmM_em9uZT0yMDI5OTAmZHNwPTM0Mzk4MyZ0PWltYWdlJnVpZD0=&uid=IM0KAQZHZYLnfAfwRsO_eV7m HTTP 302
  • https://sync.adkernel.com/user-sync?zone=202990&dsp=343983&t=image&uid=212a44e0-7977-42f2-824e-86e1ee2bbeb0
Request Chain 159
  • https://ib.adnxs.com/getuid?%2F%2Fsync.adkernel.com%2Fuser-sync%3Fzone%3D202990%26dsp%3D649145%26t%3Dimage%26uid%3D%24UID HTTP 302
  • https://sync.adkernel.com/user-sync?zone=202990&dsp=649145&t=image&uid=3070257596522025748
Request Chain 161
  • https://secure-assets.rubiconproject.com/utils/xapi/multi-sync.html?p=adkernel HTTP 301
  • https://eus.rubiconproject.com/usync.html?p=adkernel
Request Chain 165
  • https://pixel-us-east.rubiconproject.com/exchange/sync.php?p=eplanning_east&khaos=LSW6KUFC-1X-4TDE HTTP 302
  • https://sync.e-planning.net/um?uid=LSW6KUFC-1X-4TDE&dc=9bcc91305985f0db&iss=1
Request Chain 166
  • https://match.adsrvr.org/track/cmf/generic?ttd_pid=svx9t50&ttd_tpi=1&gdpr=0&gdpr_consent= HTTP 302
  • https://eb2.3lift.com/xuid?mid=3658&xuid=6ac759cd-581b-4dc6-abe7-46b63a59a046&dongle=0cfd&gdpr=0&gdpr_consent=
Request Chain 167
  • https://eb2.3lift.com/ebda?sync=1&gdpr=0&gdpr_consent= HTTP 302
  • https://cm.g.doubleclick.net/pixel?google_nid=tl&gdpr=0&gdpr_consent=&us_privacy=&google_hm=MzQyMDMxMjc3ODE2MDIzMTE3Mjc3NQ%3D%3D HTTP 302
  • https://eb2.3lift.com/ebda?gdpr=0&gdpr_consent=
Request Chain 169
  • https://eb2.3lift.com/sync/google/demand?sync=1&gdpr=0&gdpr_consent= HTTP 302
  • https://cm.g.doubleclick.net/pixel?google_nid=triplelift&gdpr=0&gdpr_consent=&us_privacy=&google_hm=MzQyMDMxMjc3ODE2MDIzMTE3Mjc3NQ%3D%3D
Request Chain 171
  • https://pr-bh.ybp.yahoo.com/sync/triplelift/3420312778160231172775?gdpr=0&gdpr_consent= HTTP 302
  • https://eb2.3lift.com/xuid?mid=2662&xuid=y-zQc8GbtE2oRan1UOjyMeGrpn0b.E3RDttWO7nYdWTw--~A&dongle=0883
Request Chain 172
  • https://x.bidswitch.net/sync?ssp=triplelift&user_id=3420312778160231172775&gdpr=0&gdpr_consent=${GDPR_CONSENT} HTTP 302
  • https://beacon.lynx.cognitivlabs.com/bidSwitch.gif?bidswitch_ssp_id=triplelift&bsw_custom_parameter=289bf088-0272-4e59-b62a-13b557cc5d81 HTTP 302
  • https://x.bidswitch.net/sync?dsp_id=425&user_group=1&expires=365&user_id=561e72bd-6a84-4c88-9110-da61b7e5966a&ssp=triplelift&bsw_param=289bf088-0272-4e59-b62a-13b557cc5d81 HTTP 302
  • https://eb2.3lift.com/xuid?mid=2409&xuid=289bf088-0272-4e59-b62a-13b557cc5d81&dongle=d3d3&gdpr=&gdpr_consent=&gdpr_pd=
Request Chain 174
  • https://ib.adnxs.com/getuid?https%3A%2F%2Feb2.3lift.com%2Fxuid%3Fmid%3D3335%26xuid%3D%24UID%26dongle%3D4d58%26gdpr=0%26gdpr_consent= HTTP 302
  • https://eb2.3lift.com/xuid?mid=3335&xuid=3070257596522025748&dongle=4d58&gdpr=0&gdpr_consent=
Request Chain 177
  • https://token.rubiconproject.com/token?pid=2974&pt=n&a=1 HTTP 302
  • https://pr-bh.ybp.yahoo.com/sync/rubicon/0tdUzPuaeW2elbBxmkNBO8n5EUdSAgOZEtemQ7w0kco?csrc= HTTP 302
  • https://pixel.rubiconproject.com/tap.php?v=31950&nid=2974&put=y-K_gaW3dE2oJd8zG3TXMDnFCbJDlQm74fPJAmfA--~A
Request Chain 178
  • https://token.rubiconproject.com/token?pid=36584 HTTP 302
  • https://px.ads.linkedin.com/setuid?partner=rubiconDb&dbredirect=true&ruxId=LSW6KUFC-1X-4TDE
Request Chain 179
  • https://match.adsrvr.org/track/cmf/rubicon HTTP 302
  • https://pixel.rubiconproject.com/tap.php?v=8981&nid=2307&put=6ac759cd-581b-4dc6-abe7-46b63a59a046&gdpr=0&gdpr_consent=&expires=30
Request Chain 181
  • https://token.rubiconproject.com/token?pid=25470 HTTP 302
  • https://cm.g.doubleclick.net/pixel?google_nid=rp&google_cm&google_hm=TFNXNktVRkMtMVgtNFRERQ==
Request Chain 183
  • https://token.rubiconproject.com/token?pid=2249&pt=n HTTP 302
  • https://cm.g.doubleclick.net/pixel?google_nid=rubicon&google_hm=YTY1ZjAwMWZjNzQ0YmI2M2ZhZWZlYzNjOTBlOWM5M2RmZmMyMmFkZg
Request Chain 184
  • https://s.amazon-adsystem.com/dcm?pid=50cd21b7-d8d7-4615-9fb9-a2be831f8488&id= HTTP 302
  • https://pixel.rubiconproject.com/token?pid=2179&pt=n&puid=3XJqCOt6Qkyl6Qfi80ZITQ&rk=usync-na HTTP 302
  • https://s.amazon-adsystem.com/ecm3?ex=rubiconprojectHMT&id=3XJqCOt6Qkyl6Qfi80ZITQ
Request Chain 185
  • https://pixel.rubiconproject.com/exchange/sync.php?p=a9us HTTP 302
  • https://s.amazon-adsystem.com/ecm3?id=LSW6KUFC-1X-4TDE&ex=d-rubiconproject.com&status=ok
Request Chain 186
  • https://match.prod.bidr.io/cookie-sync/rp?bee_sync_partners=rp HTTP 303
  • https://match.prod.bidr.io/cookie-sync/rp?bee_sync_partners=rp&_bee_ppp=1 HTTP 303
  • https://pixel.rubiconproject.com/tap.php?v=183462&nid=4114&put=AABuLU7LrJsAABIZa6sJCw&expires=30
Request Chain 187
  • https://pixel.rubiconproject.com/exchange/sync.php?p=18694 HTTP 302
  • https://match.sharethrough.com/sync/v1?source_id=UiRtTsXAfjmfSDAKnR1FjWsu&source_user_id=LSW6KUFC-1X-4TDE
Request Chain 188
  • https://pixel.rubiconproject.com/exchange/sync.php?p=19564 HTTP 302
  • https://capi.connatix.com/us/pixel?puid=LSW6KUJG-1E-6AO6&pId=11&gdpr=&gdpr_consent=&us_privacy=
Request Chain 189
  • https://pixel.rubiconproject.com/exchange/sync.php?p=primis HTTP 302
  • https://live.primis.tech/live/liveCS.php?source=external&advId=100&advUuid=LSW6KUJG-1E-6AO6 HTTP 301
  • https://sync.intentiq.com/profiles_engine/ProfilesEngineServlet?at=20&mi=10&dpi=793790479&3rddpi=1725065545&3rdpcid=LSW6KUJG-1E-6AO6 HTTP 302
  • https://sync1.intentiq.com/profiles_engine/ProfilesEngineServlet?at=20&mi=10&dpi=793790479&3rddpi=1725065545&3rdpcid=LSW6KUJG-1E-6AO6&ckls=true&ci=AP9hsZmkWb&nc=false&trid=378653466
Request Chain 190
  • https://pixel.rubiconproject.com/exchange/sync.php?p=pbs-adaptmx HTTP 302
  • https://prebid.a-mo.net/setuid/magnite?uid=LSW6KUJG-1E-6AO6
Request Chain 191
  • https://pixel.rubiconproject.com/exchange/sync.php?p=sovrn HTTP 302
  • https://ce.lijit.com/merge?pid=80&3pid=LSW6KUJG-1E-6AO6 HTTP 302
  • https://ce.lijit.com/merge?pid=80&3pid=LSW6KUJG-1E-6AO6&dnr=1
Request Chain 192
  • https://token.rubiconproject.com/token?pid=26594 HTTP 302
  • https://hb.yahoo.net/cksync.php?cs=1&type=58160&ovsid=LSW6KUFC-1X-4TDE
Request Chain 194
  • https://pixel.rubiconproject.com/exchange/sync.php?p=adkernel&khaos=LSW6KUIZ-W-MCY9 HTTP 302
  • https://sync.adkernel.com/user-sync?dsp=84&t=image&uid=LSW6KUIZ-W-MCY9
Request Chain 195
  • https://pixel-us-east.rubiconproject.com/exchange/sync.php?p=eplanning_east&khaos=LSW6KUJG-1E-6AO6 HTTP 302
  • https://sync.e-planning.net/um?uid=LSW6KUJG-1E-6AO6&dc=9bcc91305985f0db&iss=1
Request Chain 196
  • https://match.adsrvr.org/track/cmf/generic?ttd_pid=svx9t50&ttd_tpi=1&gdpr=0&gdpr_consent= HTTP 302
  • https://eb2.3lift.com/xuid?mid=3658&xuid=6ac759cd-581b-4dc6-abe7-46b63a59a046&dongle=0cfd&gdpr=0&gdpr_consent=
Request Chain 197
  • https://eb2.3lift.com/ebda?sync=1&gdpr=0&gdpr_consent= HTTP 302
  • https://cm.g.doubleclick.net/pixel?google_nid=tl&gdpr=0&gdpr_consent=&us_privacy=&google_hm=NDM3NTQwMTIxMzAzNDIyMTI0MjU0NQ%3D%3D HTTP 302
  • https://eb2.3lift.com/ebda?gdpr=0&gdpr_consent=
Request Chain 199
  • https://eb2.3lift.com/sync/google/demand?sync=1&gdpr=0&gdpr_consent= HTTP 302
  • https://cm.g.doubleclick.net/pixel?google_nid=triplelift&gdpr=0&gdpr_consent=&us_privacy=&google_hm=NDM3NTQwMTIxMzAzNDIyMTI0MjU0NQ%3D%3D
Request Chain 201
  • https://pr-bh.ybp.yahoo.com/sync/triplelift/4375401213034221242545?gdpr=0&gdpr_consent= HTTP 302
  • https://eb2.3lift.com/xuid?mid=2662&xuid=y-GP06X7NE2oTRv4jZ6GWEP1eHEr89WYFFou8Lp_f1.Q--~A&dongle=0883
Request Chain 202
  • https://x.bidswitch.net/sync?ssp=triplelift&user_id=4375401213034221242545&gdpr=0&gdpr_consent=${GDPR_CONSENT} HTTP 302
  • https://r.bidswitch.net/sync?bidswitch_ssp_id=triplelift&bsw_custom_parameter=289bf088-0272-4e59-b62a-13b557cc5d81 HTTP 302
  • https://x.bidswitch.net/sync?dsp_id=393&user_id=0&ssp=triplelift&bsw_param=289bf088-0272-4e59-b62a-13b557cc5d81 HTTP 302
  • https://eb2.3lift.com/xuid?mid=2409&xuid=289bf088-0272-4e59-b62a-13b557cc5d81&dongle=d3d3&gdpr=&gdpr_consent=&gdpr_pd=
Request Chain 204
  • https://ib.adnxs.com/getuid?https%3A%2F%2Feb2.3lift.com%2Fxuid%3Fmid%3D3335%26xuid%3D%24UID%26dongle%3D4d58%26gdpr=0%26gdpr_consent= HTTP 302
  • https://eb2.3lift.com/xuid?mid=3335&xuid=3070257596522025748&dongle=4d58&gdpr=0&gdpr_consent=
Request Chain 208
  • https://ib.adnxs.com/getuid?https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTc4JnRsPTE1NzY4MDA=&piggybackCookie=$UID&gdpr=0&gdpr_consent= HTTP 302
  • https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTc4JnRsPTE1NzY4MDA=&piggybackCookie=3070257596522025748&gdpr=0&gdpr_consent=
Request Chain 209
  • https://match.prod.bidr.io/cookie-sync/pm?gdpr=0&gdpr_consent= HTTP 303
  • https://match.prod.bidr.io/cookie-sync/pm?gdpr=0&gdpr_consent=&_bee_ppp=1 HTTP 303
  • https://cm.g.doubleclick.net/pixel?google_nid=beeswaxio&google_sc=&google_hm=QUFCU0JVN0xySnNBQUJKWXRMcFhvdw&gdpr=0&gdpr_consent=&bee_sync_partners=sas%2Cpp%2Csyn%2Cpm&bee_sync_current_partner=adx&bee_sync_initiator=pm&bee_sync_hop_count=1 HTTP 302
  • https://match.prod.bidr.io/cookie-sync/adx?gdpr=0&gdpr_consent=&bee_sync_partners=sas%2Cpp%2Csyn%2Cpm&bee_sync_current_partner=adx&bee_sync_initiator=pm&bee_sync_hop_count=1 HTTP 303
  • https://rtb-csync.smartadserver.com/redir?partneruserid=AABuLU7LrJsAABIZa6sJCw&partnerid=127&redirurl=https%3A%2F%2Fmatch.prod.bidr.io%2Fcookie-sync%3Fgdpr%3D0%26bee_sync_partners%3Dpp%252Csyn%252Cpm%26bee_sync_current_partner%3Dsas%26bee_sync_initiator%3Dadx%26bee_sync_hop_count%3D2%26userid%3DSMART_USER_ID&gdpr=0 HTTP 302
  • https://match.prod.bidr.io/cookie-sync?gdpr=0&bee_sync_partners=pp%2Csyn%2Cpm&bee_sync_current_partner=sas&bee_sync_initiator=adx&bee_sync_hop_count=2&userid=2841427660670601809&gdpr=0&gdpr_consent= HTTP 303
  • https://bh.contextweb.com/bh/rtset?ev=AABuLU7LrJsAABIZa6sJCw&do=add&pid=558502&rurl=https%3A%2F%2Fmatch.prod.bidr.io%2Fcookie-sync%3Fgdpr%3D0%26userid%3D2841427660670601809%26gdpr%3D0%26gdpr_consent%3D%26bee_sync_partners%3Dsyn%252Cpm%26bee_sync_current_partner%3Dpp%26bee_sync_initiator%3Dadx%26bee_sync_hop_count%3D3&gdpr=0 HTTP 302
  • https://match.prod.bidr.io/cookie-sync?gdpr=0&userid=2841427660670601809&gdpr=0&gdpr_consent=&bee_sync_partners=syn%2Cpm&bee_sync_current_partner=pp&bee_sync_initiator=adx&bee_sync_hop_count=3&ev=AABuLU7LrJsAABIZa6sJCw&pid=558502&do=add&gdpr=0 HTTP 303
  • https://sync.technoratimedia.com/services?uid=AABuLU7LrJsAABIZa6sJCw&srv=cs&pid=73&cb=https%3A%2F%2Fmatch.prod.bidr.io%2Fcookie-sync%3Fgdpr%3D0%26userid%3D2841427660670601809%26gdpr%3D0%26gdpr%3D0%26bee_sync_partners%3Dpm%26bee_sync_current_partner%3Dsyn%26bee_sync_initiator%3Dadx%26bee_sync_hop_count%3D4&gdpr=0 HTTP 307
  • https://ssum-sec.casalemedia.com/usermatchredir?s=191740&cb=https%3A%2F%2Fsync.technoratimedia.com%2Fservices%3Fsrv%3Dcs%26nuid%3D257E64830589451D8894D2F2712F0B7F%26att%3D1%26pid%3D82%26cb%3Dhttps%253A%252F%252Fmatch.prod.bidr.io%252Fcookie-sync%253Fgdpr%253D0%2526userid%253D2841427660670601809%2526gdpr%253D0%2526gdpr%253D0%2526bee_sync_partners%253Dpm%2526bee_sync_current_partner%253Dsyn%2526bee_sync_initiator%253Dadx%2526bee_sync_hop_count%253D4%26uid%3D HTTP 302
  • https://sync.technoratimedia.com/services?srv=cs&nuid=257E64830589451D8894D2F2712F0B7F&att=1&pid=82&cb=https%3A%2F%2Fmatch.prod.bidr.io%2Fcookie-sync%3Fgdpr%3D0%26userid%3D2841427660670601809%26gdpr%3D0%26gdpr%3D0%26bee_sync_partners%3Dpm%26bee_sync_current_partner%3Dsyn%26bee_sync_initiator%3Dadx%26bee_sync_hop_count%3D4&uid=ZdZNVdHM4ZgAAAdJAE2s5QAA%262470 HTTP 307
  • https://match.prod.bidr.io/cookie-sync?gdpr=0&userid=2841427660670601809&gdpr=0&gdpr=0&bee_sync_partners=pm&bee_sync_current_partner=syn&bee_sync_initiator=adx&bee_sync_hop_count=4 HTTP 303
  • https://image2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTMyOTcmdGw9MTI5NjAw&piggybackCookie=AABuLU7LrJsAABIZa6sJCw&gdpr=0
Request Chain 210
  • https://cm.adgrx.com/bridge?AG_PID=pubmatic&AG_SETCOOKIE&gdpr=0&gdpr_consent= HTTP 302
  • https://cm.adgrx.com/bridge.gif?AG_PID=pubmatic&gdpr=0&gdpr_consent= HTTP 302
  • https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTMzMDEmdGw9MTI5NjAw&piggybackCookie=807f0ffa-d0ee-11ee-b8b5-8e4fa7d130c9
Request Chain 211
  • https://sync-tm.everesttech.net/upi/pid/b9pj45k4?redir=https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZqcz0xJmNvZGU9MjE5MSZ0bD0yNTkyMDA=&piggybackCookie=${TM_USER_ID}&gdpr=1&gdpr_consent= HTTP 302
  • https://sync-tm.everesttech.net/ct/upi/pid/b9pj45k4?redir=https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZqcz0xJmNvZGU9MjE5MSZ0bD0yNTkyMDA=&piggybackCookie=${TM_USER_ID}&gdpr=1&gdpr_consent=&_test=ZdZNWAAGp4zQ9ABK
Request Chain 213
  • https://cms.quantserve.com/pixel/p-5aWVS_roA1dVM.gif?idmatch=0&gdpr=0&gdpr_consent= HTTP 302
  • https://image2.pubmatic.com/AdServer/Pug?gdpr=0&vcode=bz0yJnR5cGU9MSZjb2RlPTExMTMmdGw9NDMyMDA=&piggybackCookie=kl-aqpAOy6WJWcqox1rT_sBYyauJWZv4kV-Yqc5k
Request Chain 214
  • https://x.bidswitch.net/sync?ssp=pubmatic&gdpr=0&gdpr_consent=&us_privacy= HTTP 302
  • https://rtb.adstanding.com/ssp/bidswitch/cookie?bidswitch_ssp_id=pubmatic&bidswitch_custom_parameter=289bf088-0272-4e59-b62a-13b557cc5d81 HTTP 302
  • https://x.bidswitch.net/sync?dsp_id=317&user_id=ffecd92e2b79b82a2cdd3f6bf8e4de70&expires=30&ssp=pubmatic&bsw_param=289bf088-0272-4e59-b62a-13b557cc5d81 HTTP 302
  • https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZqcz0xJmNvZGU9Mjk0NSZ0bD0xMjk2MDA=&piggybackCookie=289bf088-0272-4e59-b62a-13b557cc5d81&gdpr=&gdpr_consent=&gdpr_pd=&us_privacy=
Request Chain 215
  • https://p.rfihub.com/cm?pub=224&in=1&getuid=https%3A//image2.pubmatic.com/AdServer/Pug%3Fvcode%3Dbz0yJnR5cGU9MSZjb2RlPTI3MzkmdGw9MTI5NjAw%26piggybackCookie%3D%24UID%26gdpr%3D0%26gdpr_consent%3D HTTP 302
  • https://image2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTI3MzkmdGw9MTI5NjAw&piggybackCookie=1813050729988763840
Request Chain 217
  • https://beacon.lynx.cognitivlabs.com/pbmtc.gif?redir=https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0xJnR5cGU9MSZjb2RlPTM0MzkmdGw9MTI5NjAw&piggybackCookie=$UID HTTP 302
  • https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0xJnR5cGU9MSZjb2RlPTM0MzkmdGw9MTI5NjAw&piggybackCookie=d1c0d6af-4453-4382-b5f3-cde923f2364a&r=https://beacon.lynx.cognitivlabs.com/pbmtc.gif?puid=${PUBMATIC_UID} HTTP 302
  • https://beacon.lynx.cognitivlabs.com/pbmtc.gif?puid=CBF00FF6-FEA1-42AB-B113-53FFB027089E
Request Chain 224
  • https://cm.g.doubleclick.net/pixel?google_nid=pmeb&google_sc=1&google_hm=y_AP9v6hQquxE1P_sCcIng%3D%3D&gdpr=0&gdpr_consent= HTTP 302
  • https://ads.pubmatic.com/AdServer/js/user_sync.html?p=156578&predirect=&gdpr=0&gdpr_consent=
Request Chain 225
  • https://pixel.tapad.com/idsync/ex/receive?partner_id=3371&partner_device_id=CBF00FF6-FEA1-42AB-B113-53FFB027089E HTTP 302
  • https://pixel.tapad.com/idsync/ex/receive/check?partner_id=3371&partner_device_id=CBF00FF6-FEA1-42AB-B113-53FFB027089E HTTP 302
  • https://match.adsrvr.org/track/cmf/generic?ttd_pid=tapad&ttd_tpi=1&ttd_puid=c43dfc6b-74d9-4c90-9ffb-a47ab816a7cb%252C%252C&gdpr=0&gdpr_consent= HTTP 302
  • https://pixel.tapad.com/idsync/ex/receive?partner_id=1830&partner_device_id=6ac759cd-581b-4dc6-abe7-46b63a59a046&ttd_puid=c43dfc6b-74d9-4c90-9ffb-a47ab816a7cb%2C%2C
Request Chain 228
  • https://cm.g.doubleclick.net/pixel?google_nid=pubmatic&google_hm=Q0JGMDBGRjYtRkVBMS00MkFCLUIxMTMtNTNGRkIwMjcwODlF&gdpr=0&gdpr_consent= HTTP 302
  • https://image2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTM0MjImdGw9MTI5NjAw&gdpr=0&gdpr_consent=
Request Chain 229
  • https://cm.g.doubleclick.net/pixel?google_nid=pubmatic&google_cm&google_sc&gdpr=0&gdpr_consent= HTTP 302
  • https://image2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTIxNzcmdGw9MTI5NjAw&gdpr=0&gdpr_consent=&google_error=15
Request Chain 230
  • https://um.simpli.fi/pubmatic?https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZqcz0xJmNvZGU9ODA2JnRsPTUxODQwMA==&piggybackCookie=uid:$UID&gdpr=0&gdpr_consent= HTTP 302
  • https://image2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTgwNiZ0bD01MTg0MDA=&piggybackCookie=uid:F9F3D2AF329649C7860431F114E065D0
Request Chain 231
  • https://match.adsrvr.org/track/cmf/generic?ttd_pid=pubmatic&ttd_tpi=1&gdpr=0&gdpr_consent= HTTP 302
  • https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTI4NDkmdGw9MTI5NjAw&piggybackCookie=6ac759cd-581b-4dc6-abe7-46b63a59a046&gdpr=0&gdpr_consent=
Request Chain 233
  • https://ups.analytics.yahoo.com/ups/58292/sync?_origin=1&uid=CBF00FF6-FEA1-42AB-B113-53FFB027089E&redir=true&gdpr=0&gdpr_consent= HTTP 302
  • https://ups.analytics.yahoo.com/ups/58292/sync?_origin=1&uid=CBF00FF6-FEA1-42AB-B113-53FFB027089E&redir=true&gdpr=0&gdpr_consent=&verify=true HTTP 302
  • https://image4.pubmatic.com/AdServer/SPug?partnerID=156078&xid=y-zV2czOFE2uUPYbx1Imn78aeIiMaA7Sw-~A&gdpr=0
Request Chain 235
  • https://pubmatic-match.dotomi.com/match/bounce/current?networkId=17100&version=1&nuid=CBF00FF6-FEA1-42AB-B113-53FFB027089E&gdpr=0&gdpr_consent= HTTP 302
  • https://pubmatic-match.dotomi.com/match/bounce/current?DotomiTest=22736f83b28d0fbc&is_secure=true&networkId=17100&version=1&nuid=CBF00FF6-FEA1-42AB-B113-53FFB027089E&gdpr=0&gdpr_consent= HTTP 302
  • https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTQ2MSZ0bD0xMDA4MA==&piggybackCookie=AAAHP_bPND0GHgNv4f1_AAAAAAA&expiration=1708629719&nuid=CBF00FF6-FEA1-42AB-B113-53FFB027089E&is_secure=true&gdpr_consent=&gdpr=0
Request Chain 236
  • https://ad.turn.com/r/cs?pid=1&gdpr=0&gdpr_consent= HTTP 302
  • https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZqcz0xJmNvZGU9ODImdGw9MTU3NjgwMCZkcF9pZD0yMg==&piggybackCookie=2485436676656858684&gdpr=0&gdpr_consent=&us_privacy=
Request Chain 237
  • https://pmp.mxptint.net/sn.ashx?&gdpr=0&gdpr_consent= HTTP 302
  • https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZqcz0xJmNvZGU9Mjc0NCZ0bD0xNTc2ODAw&piggybackCookie=R35CA9_1113F4AD2_62CF7198&r=https://pmp.mxptint.net/sn.ashx?ak=1 HTTP 302
  • https://pmp.mxptint.net/sn.ashx?ak=1
Request Chain 239
  • https://pixel-sync.sitescout.com/dmp/pixelSync?nid=3&gdpr=0&gdpr_consent= HTTP 302
  • https://image2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTE5NjkmdGw9MTI5NjAw&piggybackCookie=3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553&gdpr=0&gdpr_consent=
Request Chain 243
  • https://pixel.rubiconproject.com/exchange/sync.php?p=adkernel&khaos=LSW6KUJG-1E-6AO6 HTTP 302
  • https://sync.adkernel.com/user-sync?dsp=84&t=image&uid=LSW6KUJG-1E-6AO6
Request Chain 245
  • https://sync.mathtag.com/sync/img?mt_exid=3&gdpr=0&gdpr_consent=&redir=https%3A%2F%2Fsimage2.pubmatic.com%2FAdServer%2FPug%3Fvcode%3Dbz0yJnR5cGU9MSZjb2RlPTM2MiZ0bD0xMjk2MDA%3D%3D%26piggybackCookie%3Duid%3A%5BMM_UUID%5D HTTP 302
  • https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTM2MiZ0bD0xMjk2MDA==&piggybackCookie=uid:7d3865d6-4d56-4600-8c23-a9a5b19c894d&gdpr=0&gdpr_consent=
Request Chain 246
  • https://t.adx.opera.com/pub/sync?pubid=pub8730968190912 HTTP 302
  • https://image2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTM0ODkmdGw9NDMyMDA=&piggybackCookie=OPU27f663e31dbb44e08d62ff8e96f2f82f
Request Chain 249
  • https://sync.1rx.io/usersync2/pubmatic&gdpr=0&gdpr_consent= HTTP 302
  • https://match.adsrvr.org/track/cmf/generic?ttd_pid=adconductor&ttd_tpi=1&rndcb=8072606251 HTTP 302
  • https://sync.1rx.io/usersync/tradedesk/6ac759cd-581b-4dc6-abe7-46b63a59a046 HTTP 302
  • https://sync.targeting.unrulymedia.com/csync/RX-704c440e-c06a-4152-9309-008e3de3e6e8-005?redir=https%3A%2F%2Fsimage2.pubmatic.com%2FAdServer%2FPug%3Fvcode%3Dbz0yJnR5cGU9MSZjb2RlPTMyMDMmdGw9NDMyMDA%3D%26piggybackCookie%3DRX-704c440e-c06a-4152-9309-008e3de3e6e8-005 HTTP 302
  • https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTMyMDMmdGw9NDMyMDA=&piggybackCookie=RX-704c440e-c06a-4152-9309-008e3de3e6e8-005
Request Chain 253
  • https://px.owneriq.net/epm?https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTMwNzMmdGw9MTI5NjAw&piggybackCookie=$UID HTTP 302
  • https://px.owneriq.net/ecc?redir=https%3a%2f%2fsimage2.pubmatic.com%2fAdServer%2fPug%3fvcode%3dbz0yJnR5cGU9MSZjb2RlPTMwNzMmdGw9MTI5NjAw%26piggybackCookie%3dQ7618297251980074131&uid=Q7618297251980074131&ref=%2Fepm HTTP 302
  • https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTMwNzMmdGw9MTI5NjAw&piggybackCookie=Q7618297251980074131
Request Chain 254
  • https://um.simpli.fi/pm_match?https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZqcz0xJmNvZGU9MjkzNiZ0bD00MzIwMA==&piggybackCookie=uid:$UID&gdpr=0&gdpr_consent= HTTP 302
  • https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZqcz0xJmNvZGU9MjkzNiZ0bD00MzIwMA==&piggybackCookie=uid:F9F3D2AF329649C7860431F114E065D0&gdpr=0&gdpr_consent=
Request Chain 260
  • https://match.adsby.bidtheatre.com/pubmaticmatch?redir=https://simage2.pubmatic.com/AdServer/Pug?vcode=bz0yJnR5cGU9MSZjb2RlPTMwNjImdGw9MTI5NjAw&piggybackCookie=uid:$UID&gdpr=0&gdpr_consent= HTTP 302
  • https://simage2.pubmatic.com/AdServer/Pug?gdpr_consent=&gdpr=0&piggybackCookie=uid:ae750c4a-6b98-4128-82c0-93dbb2f85483&vcode=bz0yJnR5cGU9MSZjb2RlPTMwNjImdGw9MTI5NjAw
Request Chain 265
  • https://idsync.rlcdn.com/712188.gif?partner_uid=CBF00FF6-FEA1-42AB-B113-53FFB027089E&gdpr=0&gdpr_consent= HTTP 307
  • https://idsync.rlcdn.com/1000.gif?memo=CPy7KxIwCiwIARCFpQoaJENCRjAwRkY2LUZFQTEtNDJBQi1CMTEzLTUzRkZCMDI3MDg5RRAAGg0I2prZrgYSBQjoBxAAQgBKAA HTTP 307
  • https://pippio.com/api/sync?pid=5324&it=1&iv=98e018767cba71115f74cbfed31620654c7b14eaed8434a74d1fdc19289a98de791426b5417dce21&_=2 HTTP 307
  • https://px.ads.linkedin.com/db_sync?pid=10339&puuid=98e018767cba71115f74cbfed31620654c7b14eaed8434a74d1fdc19289a98de791426b5417dce21&rand=06692029

273 HTTP transactions

Resource
Path
Size
x-fer
Type
MIME-Type
Primary Request 29f836b1c2dd7f7b
ads.us.e-planning.net/uspd/1/
Redirect Chain
  • https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ruidm=1&du=//sync.adkernel.com/user-sync?zone=181225&dsp=629319&t=iframe&uid=$uid&gdpr=1&gdpr_consent=cp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_...
  • https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ct=1&ruidm=1&du=//sync.adkernel.com/user-sync?zone=181225&dsp=629319&t=iframe&uid=$uid&gdpr=1&gdpr_consent=cp6vgiap6vgiaakazaenaoesap_gaepgaciq...
4 KB
2 KB
Document
General
Full URL
https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ct=1&ruidm=1&du=//sync.adkernel.com/user-sync?zone=181225&dsp=629319&t=iframe&uid=$uid&gdpr=1&gdpr_consent=cp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa&us_privacy=1---
Protocol
H2
Security
TLS 1.3, , AES_256_GCM
Server
172.98.26.246 Ashburn, United States, ASN399668 (E-PLANNING-, US),
Reverse DNS
ads.us.e-planning.net
Software
openresty /
Resource Hash
1b0c10b83dc891747d7522d7ccf101c54da011dec6b972417de35197e6e890fc

Request headers

Upgrade-Insecure-Requests
1
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/121.0.6167.184 Safari/537.36
accept-language
en-US,en;q=0.9

Response headers

cache-control
max-age=0, no-cache
content-encoding
gzip
content-type
text/html
date
Wed, 21 Feb 2024 19:21:57 GMT
expires
Wed, 21 Feb 2024 19:21:57 GMT
p3p
policyref="http://ads.us.e-planning.net/p3p/eplanning.p3p", CP="NOI DSP COR NID CURa DEVa TAIa PSAa PSDa OUR IND UNI COM NAV"
server
openresty
x-sid
IAD-1218

Redirect headers

content-type
text/html; charset=iso-8859-1
date
Wed, 21 Feb 2024 19:21:57 GMT
location
/uspd/1/29f836b1c2dd7f7b?ct=1&ruidm=1&du=//sync.adkernel.com/user-sync?zone=181225&dsp=629319&t=iframe&uid=$uid&gdpr=1&gdpr_consent=cp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa&us_privacy=1---
p3p
policyref="http://ads.us.e-planning.net/p3p/eplanning.p3p", CP="NOI DSP COR NID CURa DEVa TAIa PSAa PSDa OUR IND UNI COM NAV"
server
openresty
x-sid
IAD-1218
um
sync.e-planning.net/
Redirect Chain
  • https://pixel-sync.sitescout.com/dmp/pixelSync?nid=49&redir=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D%7BuserId%7D%26dc%3D0abbcb4eba840e59%26fi%3Db811aede6e4aa661
  • https://pixel-sync.sitescout.com/dmp/pixelSync?cookieQ=1&nid=49&redir=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D%7BuserId%7D%26dc%3D0abbcb4eba840e59%26fi%3Db811aede6e4aa661
  • https://sync.crwdcntrl.net/qmap?c=1389&tp=STSC&tpid=3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553&gdpr=0&gdpr_consent=&d=https%3A%2F%2Fpixel.tapad.com%2Fidsync%2Fex%2Fpush%3Fpartner_id%3D2499%...
  • https://sync.crwdcntrl.net/qmap?c=1389&tp=STSC&tpid=3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553&gdpr=0&gdpr_consent=&d=https%3A%2F%2Fpixel.tapad.com%2Fidsync%2Fex%2Fpush%3Fpartner_id%3D2499%...
  • https://pixel.tapad.com/idsync/ex/push?partner_id=2499&partner_device_id=3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553&partner_url=https%3A%2F%2Fsync.e-planning.net%2Fum%3Fuid%3D3c27854a-a12b-...
  • https://pixel.tapad.com/idsync/ex/push/check?partner_id=2499&partner_device_id=3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553&partner_url=https%3A%2F%2Fsync.e-planning.net%2Fum%3Fuid%3D3c27854a...
  • https://sync.e-planning.net/um?uid=3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553&dc=0abbcb4eba840e59&iss=1
42 B
103 B
Image
General
Full URL
https://sync.e-planning.net/um?uid=3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553&dc=0abbcb4eba840e59&iss=1
Requested by
Host: ads.us.e-planning.net
URL: https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ct=1&ruidm=1&du=//sync.adkernel.com/user-sync?zone=181225&dsp=629319&t=iframe&uid=$uid&gdpr=1&gdpr_consent=cp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa&us_privacy=1---
Protocol
H2
Server
172.98.26.246 Ashburn, United States, ASN399668 (E-PLANNING-, US),
Reverse DNS
ads.us.e-planning.net
Software
openresty /
Resource Hash
ef1955ae757c8b966c83248350331bd3a30f658ced11f387f8ebf05ab3368629

Request headers

accept-language
en-US,en;q=0.9
Referer
https://ads.us.e-planning.net/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/121.0.6167.184 Safari/537.36

Response headers

server
openresty
date
Wed, 21 Feb 2024 19:22:00 GMT
content-type
image/gif

Redirect headers

date
Wed, 21 Feb 2024 19:22:00 GMT
strict-transport-security
max-age=31536000
via
1.1 google
accept-ch
Sec-CH-UA, Sec-CH-UA-Arch, Sec-CH-UA-Bitness, Sec-CH-UA-Full-Version-List, Sec-CH-UA-Mobile, Sec-CH-UA-Model, Sec-CH-UA-Platform, Sec-CH-UA-Platform-Version, Sec-CH-UA-WoW64
server
Jetty(11.0.13)
p3p
policyref="http://tapad-taptags.s3.amazonaws.com/policy/p3p.xml", CP="NOI DSP COR ADM PSAo PSDo OURo SAMo UNRo OTRo BUS COM NAV DEM STA PRE"
access-control-allow-origin
*
location
https://sync.e-planning.net/um?uid=3c27854a-a12b-4ec2-8a02-837da9268cc6-65d64d55-5553&dc=0abbcb4eba840e59&iss=1
alt-svc
h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
content-length
0
um
u-iad04.e-planning.net/
Redirect Chain
  • https://bh.contextweb.com/bh/rtset?pid=562965&ev=1&us_privacy=${us_privacy}&rurl=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D%%VGUID%%%26dc%3D66b7ef4184d94c10%26fi%3Db811aede6e4aa661
  • https://u-iad04.e-planning.net/um?uid=rANRdsjgURNt&dc=66b7ef4184d94c10&fi=b811aede6e4aa661&ev=1&us_privacy=${us_privacy}&pid=562965
42 B
104 B
Image
General
Full URL
https://u-iad04.e-planning.net/um?uid=rANRdsjgURNt&dc=66b7ef4184d94c10&fi=b811aede6e4aa661&ev=1&us_privacy=${us_privacy}&pid=562965
Requested by
Host: ads.us.e-planning.net
URL: https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ct=1&ruidm=1&du=//sync.adkernel.com/user-sync?zone=181225&dsp=629319&t=iframe&uid=$uid&gdpr=1&gdpr_consent=cp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa&us_privacy=1---
Protocol
H2
Server
172.98.26.246 Ashburn, United States, ASN399668 (E-PLANNING-, US),
Reverse DNS
ads.us.e-planning.net
Software
openresty /
Resource Hash
ef1955ae757c8b966c83248350331bd3a30f658ced11f387f8ebf05ab3368629

Request headers

accept-language
en-US,en;q=0.9
Referer
https://ads.us.e-planning.net/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/121.0.6167.184 Safari/537.36

Response headers

server
openresty
date
Wed, 21 Feb 2024 19:21:58 GMT
content-type
image/gif

Redirect headers

strict-transport-security
max-age=15768000
accept-ch
Sec-CH-UA,Sec-CH-UA-Arch,Sec-CH-UA-Bitness,Sec-CH-UA-Mobile,Sec-CH-UA-Model,Sec-CH-UA-Platform,Sec-CH-UA-Full-Version-List,Sec-CH-UA-Platform-Version
server
Jetty(10.0.14)
content-language
en-US
location
https://u-iad04.e-planning.net/um?uid=rANRdsjgURNt&dc=66b7ef4184d94c10&fi=b811aede6e4aa661&ev=1&us_privacy=${us_privacy}&pid=562965
p3p
policyref="/bh/w3c/p3p.xml", CP="NOI DSP COR NID CURa DEVa PSAa OUR BUS COM NAV INT"
cache-control
private, max-age=0, no-cache, no-store
cw-server
bh-deployment-5fddfb9bb8-rk6j5
expires
-1
pbs.gif
sync.admanmedia.com/
60 B
60 B
Image
General
Full URL
https://sync.admanmedia.com/pbs.gif?redir=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3D9937b3fd6e9a979a%26fi%3Db811aede6e4aa661%26uid%3D%5BUID%5D
Requested by
Host: ads.us.e-planning.net
URL: https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ct=1&ruidm=1&du=//sync.adkernel.com/user-sync?zone=181225&dsp=629319&t=iframe&uid=$uid&gdpr=1&gdpr_consent=cp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa&us_privacy=1---
Protocol
HTTP/1.1
Security
TLS 1.3, , AES_256_GCM
Server
8.2.110.17 , United States, ASN46636 (NATCOWEB, US),
Reverse DNS
Software
nginx/1.18.0 (Ubuntu) /
Resource Hash
a63dfafeb1e16958219c7a35e30625e86b3c11db90f0990fb68fa7181e7de73b

Request headers

accept-language
en-US,en;q=0.9
Referer
https://ads.us.e-planning.net/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/121.0.6167.184 Safari/537.36

Response headers

Date
Wed, 21 Feb 2024 19:21:57 GMT
Server
nginx/1.18.0 (Ubuntu)
Connection
keep-alive
Content-Length
60
Content-Type
text/plain
retargetly_030920.js
s.e-planning.net/esb/4/1/3fb8/7bb4893a30d21aef/
2 KB
1 KB
Script
General
Full URL
https://s.e-planning.net/esb/4/1/3fb8/7bb4893a30d21aef/retargetly_030920.js
Requested by
Host: ads.us.e-planning.net
URL: https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ct=1&ruidm=1&du=//sync.adkernel.com/user-sync?zone=181225&dsp=629319&t=iframe&uid=$uid&gdpr=1&gdpr_consent=cp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa&us_privacy=1---
Protocol
H2
Security
TLS 1.3, , AES_256_GCM
Server
172.98.26.242 Ashburn, United States, ASN399668 (E-PLANNING-, US),
Reverse DNS
s.e-planning.net
Software
openresty /
Resource Hash
18cbfcb608af5885f7916274b60578d32006c90e8fce3d98dbcc89a646707608

Request headers

accept-language
en-US,en;q=0.9
Referer
https://ads.us.e-planning.net/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/121.0.6167.184 Safari/537.36

Response headers

date
Wed, 21 Feb 2024 19:21:57 GMT
content-encoding
gzip
last-modified
Thu, 03 Sep 2020 18:45:03 GMT
server
openresty
etag
W/"5f5139af-857"
content-type
application/x-javascript
access-control-allow-origin
*
cache-control
max-age=157680000
expires
Mon, 19 Feb 2029 19:21:57 GMT
um
u-iad04.e-planning.net/
Redirect Chain
  • https://rtb.openx.net/sync/prebid?r=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3Dff96d1aa62deeebd%26fi%3Db811aede6e4aa661%26uid%3D%24%7BUID%7D
  • https://rtb.openx.net/sync/prebid?r=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3Dff96d1aa62deeebd%26fi%3Db811aede6e4aa661%26uid%3D%24%7BUID%7D&ox_sc=1
  • https://u-iad04.e-planning.net/um?dc=ff96d1aa62deeebd&fi=b811aede6e4aa661&uid=f2b461ff-fb7e-412b-94b2-7e89668d3fb5
42 B
103 B
Image
General
Full URL
https://u-iad04.e-planning.net/um?dc=ff96d1aa62deeebd&fi=b811aede6e4aa661&uid=f2b461ff-fb7e-412b-94b2-7e89668d3fb5
Requested by
Host: ads.us.e-planning.net
URL: https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ct=1&ruidm=1&du=//sync.adkernel.com/user-sync?zone=181225&dsp=629319&t=iframe&uid=$uid&gdpr=1&gdpr_consent=cp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa&us_privacy=1---
Protocol
H2
Server
172.98.26.246 Ashburn, United States, ASN399668 (E-PLANNING-, US),
Reverse DNS
ads.us.e-planning.net
Software
openresty /
Resource Hash
ef1955ae757c8b966c83248350331bd3a30f658ced11f387f8ebf05ab3368629

Request headers

accept-language
en-US,en;q=0.9
Referer
https://ads.us.e-planning.net/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/121.0.6167.184 Safari/537.36

Response headers

server
openresty
date
Wed, 21 Feb 2024 19:21:58 GMT
content-type
image/gif

Redirect headers

pragma
no-cache
date
Wed, 21 Feb 2024 19:21:57 GMT
via
1.1 google
content-type
text/html; charset=utf-8
location
https://u-iad04.e-planning.net/um?dc=ff96d1aa62deeebd&fi=b811aede6e4aa661&uid=f2b461ff-fb7e-412b-94b2-7e89668d3fb5
p3p
CP="CUR ADM OUR NOR STA NID"
cache-control
private, max-age=0, no-cache, must-revalidate
alt-svc
h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
content-length
145
lotame20220615.js
s.e-planning.net/esb/4/0/1992d/f6ee63a0c2353004/
566 B
520 B
Script
General
Full URL
https://s.e-planning.net/esb/4/0/1992d/f6ee63a0c2353004/lotame20220615.js
Requested by
Host: ads.us.e-planning.net
URL: https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ct=1&ruidm=1&du=//sync.adkernel.com/user-sync?zone=181225&dsp=629319&t=iframe&uid=$uid&gdpr=1&gdpr_consent=cp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa&us_privacy=1---
Protocol
H2
Security
TLS 1.3, , AES_256_GCM
Server
172.98.26.242 Ashburn, United States, ASN399668 (E-PLANNING-, US),
Reverse DNS
s.e-planning.net
Software
openresty /
Resource Hash
4f618d20d85f3163d72432606f3afa3c17b6c79954f967ec3df9a710503c9df4

Request headers

accept-language
en-US,en;q=0.9
Referer
https://ads.us.e-planning.net/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/121.0.6167.184 Safari/537.36

Response headers

date
Wed, 21 Feb 2024 19:21:57 GMT
content-encoding
gzip
last-modified
Wed, 15 Jun 2022 16:21:31 GMT
server
openresty
etag
W/"62aa070b-236"
content-type
application/x-javascript
access-control-allow-origin
*
cache-control
max-age=157680000
expires
Mon, 19 Feb 2029 19:21:57 GMT
um
u-iad04.e-planning.net/
Redirect Chain
  • https://prebid-match.dotomi.com/match/bounce/current?networkId=72582&version=1&rurl=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3Dfbb23d0ef33aad5d%26fi%3Db811aede6e4aa661%26uid%3D
  • https://prebid-match.dotomi.com/match/bounce/current?DotomiTest=df16ac4cad80fbc&is_secure=true&networkId=72582&version=1&rurl=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3Dfbb23d0ef33aad5d%26fi%...
  • https://u-iad04.e-planning.net/um?dc=fbb23d0ef33aad5d&fi=b811aede6e4aa661&uid=AAAHP_bPND0F0ANDd10_AAAAAAA&expiration=1708629718
42 B
103 B
Image
General
Full URL
https://u-iad04.e-planning.net/um?dc=fbb23d0ef33aad5d&fi=b811aede6e4aa661&uid=AAAHP_bPND0F0ANDd10_AAAAAAA&expiration=1708629718
Requested by
Host: ads.us.e-planning.net
URL: https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ct=1&ruidm=1&du=//sync.adkernel.com/user-sync?zone=181225&dsp=629319&t=iframe&uid=$uid&gdpr=1&gdpr_consent=cp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa&us_privacy=1---
Protocol
H2
Server
172.98.26.246 Ashburn, United States, ASN399668 (E-PLANNING-, US),
Reverse DNS
ads.us.e-planning.net
Software
openresty /
Resource Hash
ef1955ae757c8b966c83248350331bd3a30f658ced11f387f8ebf05ab3368629

Request headers

accept-language
en-US,en;q=0.9
Referer
https://ads.us.e-planning.net/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/121.0.6167.184 Safari/537.36

Response headers

server
openresty
date
Wed, 21 Feb 2024 19:21:58 GMT
content-type
image/gif

Redirect headers

pragma
no-cache
date
Wed, 21 Feb 2024 19:21:58 GMT
server
nginx
p3p
policyref="/w3c/p3p.xml", CP="NOI DSP NID OUR STP"
location
https://u-iad04.e-planning.net/um?dc=fbb23d0ef33aad5d&fi=b811aede6e4aa661&uid=AAAHP_bPND0F0ANDd10_AAAAAAA&expiration=1708629718
cache-control
no-cache, private, max-age=0, no-store
content-length
0
expires
0
um
u-iad04.e-planning.net/
Redirect Chain
  • https://sync.richaudience.com/f7872c90c5d3791e2b51f7edce1a0a5d/?p=25BiP9IMgN&r=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D[PDID]%26dc%3Dfabfd6762b833237%26fi%3Db811aede6e4aa661
  • https://sync.richaudience.com/f7872c90c5d3791e2b51f7edce1a0a5d/?p=25BiP9IMgN&r=https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fuid%3D[PDID]%26dc%3Dfabfd6762b833237%26fi%3Db811aede6e4aa661&rd=1
  • https://u-iad04.e-planning.net/um?uid=deb741aa-2f28-4634-8160-1zz1708543296&dc=fabfd6762b833237&fi=b811aede6e4aa661
42 B
103 B
Image
General
Full URL
https://u-iad04.e-planning.net/um?uid=deb741aa-2f28-4634-8160-1zz1708543296&dc=fabfd6762b833237&fi=b811aede6e4aa661
Requested by
Host: ads.us.e-planning.net
URL: https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ct=1&ruidm=1&du=//sync.adkernel.com/user-sync?zone=181225&dsp=629319&t=iframe&uid=$uid&gdpr=1&gdpr_consent=cp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa&us_privacy=1---
Protocol
H2
Server
172.98.26.246 Ashburn, United States, ASN399668 (E-PLANNING-, US),
Reverse DNS
ads.us.e-planning.net
Software
openresty /
Resource Hash
ef1955ae757c8b966c83248350331bd3a30f658ced11f387f8ebf05ab3368629

Request headers

accept-language
en-US,en;q=0.9
Referer
https://ads.us.e-planning.net/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/121.0.6167.184 Safari/537.36

Response headers

server
openresty
date
Wed, 21 Feb 2024 19:22:02 GMT
content-type
image/gif

Redirect headers

location
https://u-iad04.e-planning.net/um?uid=deb741aa-2f28-4634-8160-1zz1708543296&dc=fabfd6762b833237&fi=b811aede6e4aa661
date
Wed, 21 Feb 2024 19:21:36 GMT
content-type
text/html; charset=UTF-8
server
nginx/1.14.1
x-powered-by
PHP/8.2.4
p3p
CP="IDC DSP COR ADM DEVi TAIi PSA PSD IVAi IVDi CONi HIS OUR IND CNT"
um
u-iad04.e-planning.net/
Redirect Chain
  • https://ib.adnxs.com/getuid?https%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3D8103fa85295fbe60%26fi%3Db811aede6e4aa661%26uid%3D%24UID
  • https://ib.adnxs.com/bounce?%2Fgetuid%3Fhttps%253A%252F%252Fu-iad04.e-planning.net%252Fum%253Fdc%253D8103fa85295fbe60%2526fi%253Db811aede6e4aa661%2526uid%253D%2524UID
  • https://u-iad04.e-planning.net/um?dc=8103fa85295fbe60&fi=b811aede6e4aa661&uid=3070257596522025748
42 B
103 B
Image
General
Full URL
https://u-iad04.e-planning.net/um?dc=8103fa85295fbe60&fi=b811aede6e4aa661&uid=3070257596522025748
Requested by
Host: ads.us.e-planning.net
URL: https://ads.us.e-planning.net/uspd/1/29f836b1c2dd7f7b?ct=1&ruidm=1&du=//sync.adkernel.com/user-sync?zone=181225&dsp=629319&t=iframe&uid=$uid&gdpr=1&gdpr_consent=cp6vgiap6vgiaakazaenaoesap_gaepgaciqg1nx_h__bw9r8xr3aft0ey1p99j77sqxbhfje-4fzlvw_jwxx2exna36tqikmrieu3bbiqflhjdutvigaogvrydmakwcgtnkj6bkifmrm2dycf5vmqtj-qky5vp9d3fx2d-t_dv83dzyz8vhn3e5fme0ejcda58tdfv9brkb-9ipd_58v4v0_f_rk2_et1l_tevp7b-uft87_xu-9_fffpaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeqagczdqqia-yjcqi0hckbacokwgioeaaaaja0qeajgwkdgyblrcracafaameaiaauzaagaaegaqiacqaoeaaeaguaaiaaageadawabgatbaiaaqhqiuwiafasaejmiiuwiqoeggjbkbbicgqvwgclhaggermfaaacqavgaaasfgmssalykecxeg0aabaageeifqik6maqwjmy1u4om0zwkaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaacaa.yaaaaaaaaaaa&us_privacy=1---
Protocol
H2
Server
172.98.26.246 Ashburn, United States, ASN399668 (E-PLANNING-, US),
Reverse DNS
ads.us.e-planning.net
Software
openresty /
Resource Hash
ef1955ae757c8b966c83248350331bd3a30f658ced11f387f8ebf05ab3368629

Request headers

accept-language
en-US,en;q=0.9
Referer
https://ads.us.e-planning.net/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/121.0.6167.184 Safari/537.36

Response headers

server
openresty
date
Wed, 21 Feb 2024 19:21:58 GMT
content-type
image/gif

Redirect headers

pragma
no-cache
date
Wed, 21 Feb 2024 19:21:58 GMT
an-x-request-uuid
eef630e5-687b-48e5-a176-fe8d1229db78
server
nginx/1.23.4
accept-ch
Sec-CH-UA-Full-Version-List,Sec-CH-UA-Arch,Sec-CH-UA-Model,Sec-CH-UA-Platform-Version,Sec-CH-UA-Bitness
p3p
policyref="http://cdn.adnxs-simple.com/w3c/policy/p3p.xml", CP="NOI DSP COR ADM PSAo PSDo OURo SAMo UNRo OTRo BUS COM NAV DEM STA PRE"
content-type
text/html; charset=utf-8
access-control-allow-origin
*
cache-control
no-store, no-cache, private
access-control-allow-credentials
true
location
https://u-iad04.e-planning.net/um?dc=8103fa85295fbe60&fi=b811aede6e4aa661&uid=3070257596522025748
x-proxy-origin
5.182.16.6; 5.182.16.6; 673.bm-nginx-loadbalancer.mgmt.nym2.adnexus.net; adnxs.com
content-length
0
x-xss-protection
0
expires
Sat, 15 Nov 2008 16:00:00 GMT
um
u-iad04.e-planning.net/
Redirect Chain
  • https://sync.go.sonobi.com/us?loc=%0A%0Ahttps%3A%2F%2Fu-iad04.e-planning.net%2Fum%3Fdc%3De52415579699e09f%26fi%3Db811aede6e4aa661%26uid%3D%5BUID%5D
  • https://u-iad04.e-planning.net/um?dc=e52415579699e09f&fi=b811aede6e4aa661&uid=8735f714-7c55-4ddf-b4aa-f391ce20c51c
42 B
103 B
Image
General