www.fishbowlapp.com
Open in
urlscan Pro
2606:4700:4400::6812:22c2
Public Scan
URL:
https://www.fishbowlapp.com/post/can-anyone-shed-light-on-the-job-hierarchy-at-u-s-bank-associatedirectorvp-i-am-trying-to-u...
Submission: On April 30 via manual from GB — Scanned from GB
Submission: On April 30 via manual from GB — Scanned from GB
Form analysis 3 forms found in the DOM
<form _ngcontent-sc111="" novalidate="" class="js-download-phone-form ng-untouched ng-pristine ng-invalid">
<div _ngcontent-sc111="" class="buttons"><country-telephone-input _ngcontent-sc111="" formcontrolname="phone" _nghost-sc109="" class="ng-untouched ng-pristine ng-invalid"><select _ngcontent-sc109=""
class="fsb-select country-code js-country-code-select ng-untouched ng-pristine ng-valid" selectedindex="-1" value="1"><!---->
<option value="376">AD</option>
<option value="971">AE</option>
<option value="93">AF</option>
<option value="1268">AG</option>
<option value="1264">AI</option>
<option value="355">AL</option>
<option value="374">AM</option>
<option value="244">AO</option>
<option value="672">AQ</option>
<option value="54">AR</option>
<option value="1684">AS</option>
<option value="43">AT</option>
<option value="61">AU</option>
<option value="297">AW</option>
<option value="358">AX</option>
<option value="994">AZ</option>
<option value="387">BA</option>
<option value="1246">BB</option>
<option value="880">BD</option>
<option value="32">BE</option>
<option value="226">BF</option>
<option value="359">BG</option>
<option value="973">BH</option>
<option value="257">BI</option>
<option value="229">BJ</option>
<option value="590">BL</option>
<option value="1441">BM</option>
<option value="673">BN</option>
<option value="591">BO</option>
<option value="599">BQ</option>
<option value="55">BR</option>
<option value="1242">BS</option>
<option value="975">BT</option>
<option value="47">BV</option>
<option value="267">BW</option>
<option value="375">BY</option>
<option value="501">BZ</option>
<option value="1">CA</option>
<option value="61">CC</option>
<option value="243">CD</option>
<option value="236">CF</option>
<option value="242">CG</option>
<option value="41">CH</option>
<option value="225">CI</option>
<option value="682">CK</option>
<option value="56">CL</option>
<option value="237">CM</option>
<option value="86">CN</option>
<option value="57">CO</option>
<option value="506">CR</option>
<option value="238">CV</option>
<option value="599">CW</option>
<option value="61">CX</option>
<option value="357">CY</option>
<option value="420">CZ</option>
<option value="49">DE</option>
<option value="253">DJ</option>
<option value="45">DK</option>
<option value="1767">DM</option>
<option value="1">DO</option>
<option value="213">DZ</option>
<option value="593">EC</option>
<option value="372">EE</option>
<option value="20">EG</option>
<option value="212">EH</option>
<option value="291">ER</option>
<option value="34">ES</option>
<option value="251">ET</option>
<option value="358">FI</option>
<option value="679">FJ</option>
<option value="500">FK</option>
<option value="691">FM</option>
<option value="298">FO</option>
<option value="33">FR</option>
<option value="241">GA</option>
<option value="44">GB</option>
<option value="1473">GD</option>
<option value="995">GE</option>
<option value="594">GF</option>
<option value="44">GG</option>
<option value="233">GH</option>
<option value="350">GI</option>
<option value="299">GL</option>
<option value="220">GM</option>
<option value="224">GN</option>
<option value="590">GP</option>
<option value="240">GQ</option>
<option value="30">GR</option>
<option value="500">GS</option>
<option value="502">GT</option>
<option value="1671">GU</option>
<option value="245">GW</option>
<option value="592">GY</option>
<option value="852">HK</option>
<option value="672">HM</option>
<option value="504">HN</option>
<option value="385">HR</option>
<option value="509">HT</option>
<option value="36">HU</option>
<option value="62">ID</option>
<option value="353">IE</option>
<option value="972">IL</option>
<option value="44">IM</option>
<option value="91">IN</option>
<option value="246">IO</option>
<option value="964">IQ</option>
<option value="354">IS</option>
<option value="39">IT</option>
<option value="44">JE</option>
<option value="1876">JM</option>
<option value="962">JO</option>
<option value="81">JP</option>
<option value="254">KE</option>
<option value="996">KG</option>
<option value="855">KH</option>
<option value="686">KI</option>
<option value="269">KM</option>
<option value="1869">KN</option>
<option value="82">KR</option>
<option value="965">KW</option>
<option value="1345">KY</option>
<option value="7">KZ</option>
<option value="856">LA</option>
<option value="961">LB</option>
<option value="1758">LC</option>
<option value="423">LI</option>
<option value="94">LK</option>
<option value="231">LR</option>
<option value="266">LS</option>
<option value="370">LT</option>
<option value="352">LU</option>
<option value="371">LV</option>
<option value="218">LY</option>
<option value="212">MA</option>
<option value="377">MC</option>
<option value="373">MD</option>
<option value="382">ME</option>
<option value="590">MF</option>
<option value="261">MG</option>
<option value="692">MH</option>
<option value="389">MK</option>
<option value="223">ML</option>
<option value="95">MM</option>
<option value="976">MN</option>
<option value="853">MO</option>
<option value="1670">MP</option>
<option value="596">MQ</option>
<option value="222">MR</option>
<option value="1664">MS</option>
<option value="356">MT</option>
<option value="230">MU</option>
<option value="960">MV</option>
<option value="265">MW</option>
<option value="52">MX</option>
<option value="60">MY</option>
<option value="258">MZ</option>
<option value="264">NA</option>
<option value="687">NC</option>
<option value="227">NE</option>
<option value="672">NF</option>
<option value="234">NG</option>
<option value="505">NI</option>
<option value="31">NL</option>
<option value="47">NO</option>
<option value="977">NP</option>
<option value="674">NR</option>
<option value="683">NU</option>
<option value="64">NZ</option>
<option value="968">OM</option>
<option value="507">PA</option>
<option value="51">PE</option>
<option value="689">PF</option>
<option value="675">PG</option>
<option value="63">PH</option>
<option value="92">PK</option>
<option value="48">PL</option>
<option value="508">PM</option>
<option value="64">PN</option>
<option value="1">PR</option>
<option value="970">PS</option>
<option value="351">PT</option>
<option value="680">PW</option>
<option value="595">PY</option>
<option value="974">QA</option>
<option value="262">RE</option>
<option value="40">RO</option>
<option value="381">RS</option>
<option value="7">RU</option>
<option value="250">RW</option>
<option value="966">SA</option>
<option value="677">SB</option>
<option value="248">SC</option>
<option value="46">SE</option>
<option value="65">SG</option>
<option value="290">SH</option>
<option value="386">SI</option>
<option value="47">SJ</option>
<option value="421">SK</option>
<option value="232">SL</option>
<option value="378">SM</option>
<option value="221">SN</option>
<option value="252">SO</option>
<option value="597">SR</option>
<option value="211">SS</option>
<option value="239">ST</option>
<option value="503">SV</option>
<option value="1721">SX</option>
<option value="268">SZ</option>
<option value="1649">TC</option>
<option value="235">TD</option>
<option value="262">TF</option>
<option value="228">TG</option>
<option value="66">TH</option>
<option value="992">TJ</option>
<option value="690">TK</option>
<option value="670">TL</option>
<option value="993">TM</option>
<option value="216">TN</option>
<option value="676">TO</option>
<option value="90">TR</option>
<option value="1868">TT</option>
<option value="688">TV</option>
<option value="886">TW</option>
<option value="255">TZ</option>
<option value="256">UG</option>
<option value="1">UM</option>
<option value="1">US</option>
<option value="598">UY</option>
<option value="998">UZ</option>
<option value="39">VA</option>
<option value="1784">VC</option>
<option value="58">VE</option>
<option value="1284">VG</option>
<option value="1340">VI</option>
<option value="84">VN</option>
<option value="678">VU</option>
<option value="681">WF</option>
<option value="685">WS</option>
<option value="383">XK</option>
<option value="967">YE</option>
<option value="262">YT</option>
<option value="27">ZA</option>
<option value="260">ZM</option>
<option value="263">ZW</option>
</select><!----><!----><label _ngcontent-sc109="" for="phone" class="country-code-field js-country-code-label"> +1 </label>
<p _ngcontent-sc109="" class="form-floating"><input _ngcontent-sc109="" id="phone" placeholder="Phone number" type="text" aria-label="phone number" aria-required="true"
class="fsb-input js-country-code-input form-control ng-untouched ng-pristine ng-valid" value=""><label _ngcontent-sc109="" for="phone">Phone number</label></p>
</country-telephone-input><!---->
<p _ngcontent-sc111="" role="alert" class="error js-error-message" hidden=""> Please enter a valid number </p><!----><btn-with-loading _ngcontent-sc111="" class="send-sms h-50p" _nghost-sc88=""><button _ngcontent-sc88=""
class="fsb-button flex-center js-loading-btn-submit" aria-label="submit"> Send Link <!----></button><!----></btn-with-loading><!----><!----><!---->
</div>
</form><form _ngcontent-sc128="" novalidate="" id="partial-email-form" class="partial-email-form ng-untouched ng-pristine ng-invalid"><verify-email-domain-popup _ngcontent-sc128="" hidden="" _nghost-sc125="">
<div _ngcontent-sc125="" class="non-common-domain-bubble-wrapper">
<div _ngcontent-sc125="" class="non-common-domain-bubble">"" is an unusual email domain. If correct, please proceed to the next step</div><span _ngcontent-sc125="" class="arrow"><svg width="50px" height="20px" viewBox="0 0 50 17"
preserveAspectRatio="xMinYMin" xmlns="http://www.w3.org/2000/svg">
<defs>
<filter id="b" width="134.1%" height="151.8%" x="-17.1%" y="-25.7%" filterUnits="objectBoundingBox">
<feMerge>
<feMergeNode in="shadowMatrixOuter1"></feMergeNode>
<feMergeNode in="SourceGraphic"></feMergeNode>
</feMerge>
</filter>
</defs>
<path fill="#4c28ff" fill-rule="evenodd"
d="M 30.554 14.419 L 31.454 13.536 C 35.62 9.453 41.221 7.166 47.055 7.166 L 47.954 7.166 L 47.954 0 L 1.954 0 L 1.954 7.166 L 2.853 7.166 C 8.686 7.166 14.287 9.453 18.454 13.536 L 19.354 14.419 C 22.464 17.468 27.443 17.468 30.554 14.419 Z">
</path>
</svg></span><!---->
</div>
</verify-email-domain-popup>
<p _ngcontent-sc128="" class="form-floating fsb-gd"><input _ngcontent-sc128="" type="text" id="partial-email-input" placeholder="Work Email" formcontrolname="email" class="form-control fsb-input fsb-gd ng-untouched ng-pristine ng-invalid"
value=""><label _ngcontent-sc128="" for="partial-email-input">Work Email</label></p><!---->
<div _ngcontent-sc128="" class="work-email-notice"> Why work email <div _ngcontent-sc128="" class="icon-wrapper"><span _ngcontent-sc128="" class="work-email-icon blue-icon"><svg class="info-icon" xmlns="http://www.w3.org/2000/svg" width="20"
height="20" viewBox="0 0 20 20">
<title>Info icon</title>
<style>
.info-icon {
stroke: #544e5d;
}
.info-icon .fill-path {
fill: #544e5d;
}
.blue-icon .info-icon {
stroke: #4c28ff;
}
.blue-icon .info-icon .fill-path {
fill: #4c28ff;
}
</style>
<g fill="none" fill-rule="evenodd">
<path stroke-width="1.5"
d="M17.928 5.255v-.002a8.62 8.62 0 0 0-.33-.52 9.282 9.282 0 0 0-2.853-2.661 9.181 9.181 0 0 0-9.49 0A9.282 9.282 0 0 0 2.4 4.732c-.097.14-.188.287-.33.523A9.181 9.181 0 0 0 .75 10c0 1.907.582 3.728 1.652 5.266A9.23 9.23 0 0 0 10 19.25a9.23 9.23 0 0 0 7.598-3.984A9.193 9.193 0 0 0 19.25 10a9.181 9.181 0 0 0-1.322-4.745z">
</path>
<path class="fill-path" d="M11 6c0 .552-.444 1-1 1-.552 0-1-.444-1-1 0-.552.444-1 1-1 .552 0 1 .444 1 1zm0 8.92c0 .597-.444 1.08-1 1.08-.552 0-1-.477-1-1.08V9.08C9 8.483 9.444 8 10 8c.552 0 1 .476 1 1.08v5.841z"></path>
</g>
</svg></span><!---->
<div _ngcontent-sc128="" class="notice-pop-over">
<ul _ngcontent-sc128="">
<li _ngcontent-sc128=""> Participate in safe communities with other verified professionals. </li>
<li _ngcontent-sc128=""> Candidly discuss workplace matters in company exclusive channels and group chats. </li>
<li _ngcontent-sc128=""> Flexible identity preferences allows honest conversations with other colleagues. </li>
</ul><span _ngcontent-sc128="" class="popover-arrow"><svg width="50px" height="20px" viewBox="0 0 50 17" preserveAspectRatio="xMinYMin" xmlns="http://www.w3.org/2000/svg">
<defs>
<filter id="b" width="134.1%" height="151.8%" x="-17.1%" y="-25.7%" filterUnits="objectBoundingBox">
<feMerge>
<feMergeNode in="shadowMatrixOuter1"></feMergeNode>
<feMergeNode in="SourceGraphic"></feMergeNode>
</feMerge>
</filter>
</defs>
<path fill="#4c28ff" fill-rule="evenodd"
d="M 30.554 14.419 L 31.454 13.536 C 35.62 9.453 41.221 7.166 47.055 7.166 L 47.954 7.166 L 47.954 0 L 1.954 0 L 1.954 7.166 L 2.853 7.166 C 8.686 7.166 14.287 9.453 18.454 13.536 L 19.354 14.419 C 22.464 17.468 27.443 17.468 30.554 14.419 Z">
</path>
</svg></span><!---->
</div>
</div>
</div><!---->
<div _ngcontent-sc128="" class="checkbox-wrapper"><label _ngcontent-sc128="" for="marketing-unsub" class="unsub-label"> Click here if you do not want to receive marketing emails from Fishbowl and affiliates </label>
<div _ngcontent-sc128="" class="pseudo-checkbox">
<div _ngcontent-sc128="" class="checkmark"></div>
</div><input _ngcontent-sc128="" type="checkbox" formcontrolname="unsub" id="marketing-unsub" class="cdk-visually-hidden ng-untouched ng-pristine ng-valid" checked="">
</div><!---->
<p _ngcontent-sc128="" id="partial-email-error" class="email-error error error-collapsed partial-email-error"> </p><button _ngcontent-sc128="" type="button" id="partial-email-submit" class="partial-email-submit fsb-button fsb-gd"> Sign Up
</button><!----><!----><!----><!---->
<div _ngcontent-sc128="" class="blocked-email-notification-wrapper" hidden="">
<div _ngcontent-sc128="" class="blocked-email-notification"><span _ngcontent-sc128="" class="icon"></span><span _ngcontent-sc128="" class="text">We’re experiencing delivery issues to that domain.</span></div>
<div _ngcontent-sc128="" class="suggestion-text">Please choose one of the options</div>
</div>
<hr _ngcontent-sc128="" class="separator"><button _ngcontent-sc128="" type="button" class="partial-btn google-btn"><span _ngcontent-sc128="" class="icon-wrapper"><svg _ngcontent-sc128="" xmlns="http://www.w3.org/2000/svg" width="38" height="38"
viewBox="0 0 38 38" class="icon">
<g _ngcontent-sc128="" fill="none" fill-rule="evenodd">
<g _ngcontent-sc128="">
<g _ngcontent-sc128="">
<g _ngcontent-sc128="">
<g _ngcontent-sc128="">
<g _ngcontent-sc128="">
<path _ngcontent-sc128="" d="M0 0L18 0 18 18 0 18z" transform="translate(-49.000000, -564.000000) translate(10.000000, 405.000000) translate(27.000000, 156.000000) translate(12.000000, 3.000000) translate(10.000000, 10.000000)">
</path>
</g>
<g _ngcontent-sc128="">
<path _ngcontent-sc128="" fill="#4285F4" d="M17.64 9.205c0-.639-.057-1.252-.164-1.841H9v3.481h4.844c-.209 1.125-.843 2.078-1.796 2.716v2.259h2.908c1.702-1.567 2.684-3.875 2.684-6.615z"
transform="translate(-49.000000, -564.000000) translate(10.000000, 405.000000) translate(27.000000, 156.000000) translate(12.000000, 3.000000) translate(10.000000, 10.000000)"></path>
<path _ngcontent-sc128="" fill="#34A853" d="M9 18c2.43 0 4.467-.806 5.956-2.18l-2.908-2.259c-.806.54-1.837.86-3.048.86-2.344 0-4.328-1.584-5.036-3.711H.957v2.332C2.438 15.983 5.482 18 9 18z"
transform="translate(-49.000000, -564.000000) translate(10.000000, 405.000000) translate(27.000000, 156.000000) translate(12.000000, 3.000000) translate(10.000000, 10.000000)"></path>
<path _ngcontent-sc128="" fill="#FBBC05" d="M3.964 10.71c-.18-.54-.282-1.117-.282-1.71s.102-1.17.282-1.71V4.958H.957C.347 6.173 0 7.548 0 9s.348 2.827.957 4.042l3.007-2.332z"
transform="translate(-49.000000, -564.000000) translate(10.000000, 405.000000) translate(27.000000, 156.000000) translate(12.000000, 3.000000) translate(10.000000, 10.000000)"></path>
<path _ngcontent-sc128="" fill="#EA4335" d="M9 3.58c1.321 0 2.508.454 3.44 1.345l2.582-2.58C13.463.891 11.426 0 9 0 5.482 0 2.438 2.017.957 4.958L3.964 7.29C4.672 5.163 6.656 3.58 9 3.58z"
transform="translate(-49.000000, -564.000000) translate(10.000000, 405.000000) translate(27.000000, 156.000000) translate(12.000000, 3.000000) translate(10.000000, 10.000000)"></path>
</g>
</g>
</g>
</g>
</g>
</g>
</svg></span><span _ngcontent-sc128="" class="icon-separator"></span> Continue with Google </button><button _ngcontent-sc128="" type="button" class="partial-btn linkedin-btn"><span _ngcontent-sc128="" class="icon-wrapper"><svg
_ngcontent-sc128="" xmlns="http://www.w3.org/2000/svg" width="20" height="19" viewBox="0 0 20 19" class="icon">
<g _ngcontent-sc128="" fill="none" fill-rule="evenodd">
<g _ngcontent-sc128="">
<g _ngcontent-sc128="">
<g _ngcontent-sc128="">
<g _ngcontent-sc128="" transform="translate(-59.000000, -627.000000) translate(10.000000, 405.000000) translate(27.000000, 156.000000) translate(0.000000, 54.000000)">
<g _ngcontent-sc128="" transform="translate(22.000000, 12.000000)">
<g _ngcontent-sc128="" fill="#0976b4">
<path _ngcontent-sc128=""
d="M2.465 4.508c1.361 0 2.464-1.008 2.464-2.253C4.93 1.01 3.826 0 2.465 0 1.103 0 0 1.01 0 2.255 0 3.5 1.103 4.508 2.465 4.508M.565 19L4.986 19 4.986 6.224.565 6.224zM11.191 11.894c0-1.465.692-2.897 2.346-2.897 1.655 0 2.062 1.432 2.062 2.862v6.978H20v-7.263c0-5.046-2.977-5.915-4.808-5.915-1.83 0-2.84.62-4 2.122v-1.72H6.776v12.776h4.414v-6.943z">
</path>
</g>
</g>
</g>
</g>
</g>
</g>
</g>
</svg></span><span _ngcontent-sc128="" class="icon-separator"></span> Continue with Linkedin </button><!----><!---->
</form><form _ngcontent-sc128="" novalidate="" id="partial-email-form" class="partial-email-form ng-untouched ng-pristine ng-invalid"><verify-email-domain-popup _ngcontent-sc128="" hidden="" _nghost-sc125="">
<div _ngcontent-sc125="" class="non-common-domain-bubble-wrapper">
<div _ngcontent-sc125="" class="non-common-domain-bubble">"" is an unusual email domain. If correct, please proceed to the next step</div><span _ngcontent-sc125="" class="arrow"><svg width="50px" height="20px" viewBox="0 0 50 17"
preserveAspectRatio="xMinYMin" xmlns="http://www.w3.org/2000/svg">
<defs>
<filter id="b" width="134.1%" height="151.8%" x="-17.1%" y="-25.7%" filterUnits="objectBoundingBox">
<feMerge>
<feMergeNode in="shadowMatrixOuter1"></feMergeNode>
<feMergeNode in="SourceGraphic"></feMergeNode>
</feMerge>
</filter>
</defs>
<path fill="#4c28ff" fill-rule="evenodd"
d="M 30.554 14.419 L 31.454 13.536 C 35.62 9.453 41.221 7.166 47.055 7.166 L 47.954 7.166 L 47.954 0 L 1.954 0 L 1.954 7.166 L 2.853 7.166 C 8.686 7.166 14.287 9.453 18.454 13.536 L 19.354 14.419 C 22.464 17.468 27.443 17.468 30.554 14.419 Z">
</path>
</svg></span><!---->
</div>
</verify-email-domain-popup>
<p _ngcontent-sc128="" class="form-floating fsb-gd"><input _ngcontent-sc128="" type="text" id="partial-email-input" placeholder="Work Email" formcontrolname="email" class="form-control fsb-input fsb-gd ng-untouched ng-pristine ng-invalid"
value=""><label _ngcontent-sc128="" for="partial-email-input">Work Email</label></p><!---->
<div _ngcontent-sc128="" class="work-email-notice"> Why work email <div _ngcontent-sc128="" class="icon-wrapper"><span _ngcontent-sc128="" class="work-email-icon blue-icon"><svg class="info-icon" xmlns="http://www.w3.org/2000/svg" width="20"
height="20" viewBox="0 0 20 20">
<title>Info icon</title>
<style>
.info-icon {
stroke: #544e5d;
}
.info-icon .fill-path {
fill: #544e5d;
}
.blue-icon .info-icon {
stroke: #4c28ff;
}
.blue-icon .info-icon .fill-path {
fill: #4c28ff;
}
</style>
<g fill="none" fill-rule="evenodd">
<path stroke-width="1.5"
d="M17.928 5.255v-.002a8.62 8.62 0 0 0-.33-.52 9.282 9.282 0 0 0-2.853-2.661 9.181 9.181 0 0 0-9.49 0A9.282 9.282 0 0 0 2.4 4.732c-.097.14-.188.287-.33.523A9.181 9.181 0 0 0 .75 10c0 1.907.582 3.728 1.652 5.266A9.23 9.23 0 0 0 10 19.25a9.23 9.23 0 0 0 7.598-3.984A9.193 9.193 0 0 0 19.25 10a9.181 9.181 0 0 0-1.322-4.745z">
</path>
<path class="fill-path" d="M11 6c0 .552-.444 1-1 1-.552 0-1-.444-1-1 0-.552.444-1 1-1 .552 0 1 .444 1 1zm0 8.92c0 .597-.444 1.08-1 1.08-.552 0-1-.477-1-1.08V9.08C9 8.483 9.444 8 10 8c.552 0 1 .476 1 1.08v5.841z"></path>
</g>
</svg></span><!---->
<div _ngcontent-sc128="" class="notice-pop-over">
<ul _ngcontent-sc128="">
<li _ngcontent-sc128=""> Participate in safe communities with other verified professionals. </li>
<li _ngcontent-sc128=""> Candidly discuss workplace matters in company exclusive channels and group chats. </li>
<li _ngcontent-sc128=""> Flexible identity preferences allows honest conversations with other colleagues. </li>
</ul><span _ngcontent-sc128="" class="popover-arrow"><svg width="50px" height="20px" viewBox="0 0 50 17" preserveAspectRatio="xMinYMin" xmlns="http://www.w3.org/2000/svg">
<defs>
<filter id="b" width="134.1%" height="151.8%" x="-17.1%" y="-25.7%" filterUnits="objectBoundingBox">
<feMerge>
<feMergeNode in="shadowMatrixOuter1"></feMergeNode>
<feMergeNode in="SourceGraphic"></feMergeNode>
</feMerge>
</filter>
</defs>
<path fill="#4c28ff" fill-rule="evenodd"
d="M 30.554 14.419 L 31.454 13.536 C 35.62 9.453 41.221 7.166 47.055 7.166 L 47.954 7.166 L 47.954 0 L 1.954 0 L 1.954 7.166 L 2.853 7.166 C 8.686 7.166 14.287 9.453 18.454 13.536 L 19.354 14.419 C 22.464 17.468 27.443 17.468 30.554 14.419 Z">
</path>
</svg></span><!---->
</div>
</div>
</div><!---->
<div _ngcontent-sc128="" class="checkbox-wrapper"><label _ngcontent-sc128="" for="marketing-unsub" class="unsub-label"> Click here if you do not want to receive marketing emails from Fishbowl and affiliates </label>
<div _ngcontent-sc128="" class="pseudo-checkbox">
<div _ngcontent-sc128="" class="checkmark"></div>
</div><input _ngcontent-sc128="" type="checkbox" formcontrolname="unsub" id="marketing-unsub" class="cdk-visually-hidden ng-untouched ng-pristine ng-valid" checked="">
</div><!---->
<p _ngcontent-sc128="" id="partial-email-error" class="email-error error error-collapsed partial-email-error"> </p><button _ngcontent-sc128="" type="button" id="partial-email-submit" class="partial-email-submit fsb-button fsb-gd"> Sign Up
</button><!----><!----><!----><!---->
<div _ngcontent-sc128="" class="blocked-email-notification-wrapper" hidden="">
<div _ngcontent-sc128="" class="blocked-email-notification"><span _ngcontent-sc128="" class="icon"></span><span _ngcontent-sc128="" class="text">We’re experiencing delivery issues to that domain.</span></div>
<div _ngcontent-sc128="" class="suggestion-text">Please choose one of the options</div>
</div>
<hr _ngcontent-sc128="" class="separator"><button _ngcontent-sc128="" type="button" class="partial-btn google-btn"><span _ngcontent-sc128="" class="icon-wrapper"><svg _ngcontent-sc128="" xmlns="http://www.w3.org/2000/svg" width="38" height="38"
viewBox="0 0 38 38" class="icon">
<g _ngcontent-sc128="" fill="none" fill-rule="evenodd">
<g _ngcontent-sc128="">
<g _ngcontent-sc128="">
<g _ngcontent-sc128="">
<g _ngcontent-sc128="">
<g _ngcontent-sc128="">
<path _ngcontent-sc128="" d="M0 0L18 0 18 18 0 18z" transform="translate(-49.000000, -564.000000) translate(10.000000, 405.000000) translate(27.000000, 156.000000) translate(12.000000, 3.000000) translate(10.000000, 10.000000)">
</path>
</g>
<g _ngcontent-sc128="">
<path _ngcontent-sc128="" fill="#4285F4" d="M17.64 9.205c0-.639-.057-1.252-.164-1.841H9v3.481h4.844c-.209 1.125-.843 2.078-1.796 2.716v2.259h2.908c1.702-1.567 2.684-3.875 2.684-6.615z"
transform="translate(-49.000000, -564.000000) translate(10.000000, 405.000000) translate(27.000000, 156.000000) translate(12.000000, 3.000000) translate(10.000000, 10.000000)"></path>
<path _ngcontent-sc128="" fill="#34A853" d="M9 18c2.43 0 4.467-.806 5.956-2.18l-2.908-2.259c-.806.54-1.837.86-3.048.86-2.344 0-4.328-1.584-5.036-3.711H.957v2.332C2.438 15.983 5.482 18 9 18z"
transform="translate(-49.000000, -564.000000) translate(10.000000, 405.000000) translate(27.000000, 156.000000) translate(12.000000, 3.000000) translate(10.000000, 10.000000)"></path>
<path _ngcontent-sc128="" fill="#FBBC05" d="M3.964 10.71c-.18-.54-.282-1.117-.282-1.71s.102-1.17.282-1.71V4.958H.957C.347 6.173 0 7.548 0 9s.348 2.827.957 4.042l3.007-2.332z"
transform="translate(-49.000000, -564.000000) translate(10.000000, 405.000000) translate(27.000000, 156.000000) translate(12.000000, 3.000000) translate(10.000000, 10.000000)"></path>
<path _ngcontent-sc128="" fill="#EA4335" d="M9 3.58c1.321 0 2.508.454 3.44 1.345l2.582-2.58C13.463.891 11.426 0 9 0 5.482 0 2.438 2.017.957 4.958L3.964 7.29C4.672 5.163 6.656 3.58 9 3.58z"
transform="translate(-49.000000, -564.000000) translate(10.000000, 405.000000) translate(27.000000, 156.000000) translate(12.000000, 3.000000) translate(10.000000, 10.000000)"></path>
</g>
</g>
</g>
</g>
</g>
</g>
</svg></span><span _ngcontent-sc128="" class="icon-separator"></span> Continue with Google </button><button _ngcontent-sc128="" type="button" class="partial-btn linkedin-btn"><span _ngcontent-sc128="" class="icon-wrapper"><svg
_ngcontent-sc128="" xmlns="http://www.w3.org/2000/svg" width="20" height="19" viewBox="0 0 20 19" class="icon">
<g _ngcontent-sc128="" fill="none" fill-rule="evenodd">
<g _ngcontent-sc128="">
<g _ngcontent-sc128="">
<g _ngcontent-sc128="">
<g _ngcontent-sc128="" transform="translate(-59.000000, -627.000000) translate(10.000000, 405.000000) translate(27.000000, 156.000000) translate(0.000000, 54.000000)">
<g _ngcontent-sc128="" transform="translate(22.000000, 12.000000)">
<g _ngcontent-sc128="" fill="#0976b4">
<path _ngcontent-sc128=""
d="M2.465 4.508c1.361 0 2.464-1.008 2.464-2.253C4.93 1.01 3.826 0 2.465 0 1.103 0 0 1.01 0 2.255 0 3.5 1.103 4.508 2.465 4.508M.565 19L4.986 19 4.986 6.224.565 6.224zM11.191 11.894c0-1.465.692-2.897 2.346-2.897 1.655 0 2.062 1.432 2.062 2.862v6.978H20v-7.263c0-5.046-2.977-5.915-4.808-5.915-1.83 0-2.84.62-4 2.122v-1.72H6.776v12.776h4.414v-6.943z">
</path>
</g>
</g>
</g>
</g>
</g>
</g>
</g>
</svg></span><span _ngcontent-sc128="" class="icon-separator"></span> Continue with Linkedin </button><!----><!---->
</form>Text Content
Companies
Bowls
Topics
Posts
Blog
Login Sign Up Get The App
Arrow icon New Posts
Chevron icon Layer 1
Browse
CommunityTopicsPostsCompanies
InsightsAboutCommunity Guidelines
Get the app
Your membership is pending review by Bowl Admins
US Banking Salaries & Designations image
US Banking Salaries & Designations
Bookmark icon
Posting as :
a Vice President
▸ US Banking Salaries & Designations
You are currently posting as works at Vice President
CAN ANYONE SHED LIGHT ON THE JOB HIERARCHY AT U.S.BANK ASSOCIATE>DIRECTOR>VP. I
AM TRYING TO UNDERSTAND THE HIERARCHY OF THE DIRECTOR ROLE. SECONDLY WHAT WOULD
BE A AVERAGE PAY FOR DIGITAL ANALYTICS DIRECTOR WITH TABLEAU/POWER BI AND PYTHON
ASK? GLASSDOOR HAS AN AVERAGE SO WANT TO CONFIRM SAME OFFERING FROM EXPERIENCED
EMPLOYEES? THIS JOB IS REMOTE IN THE US.
Like icon Like Comment icon 3 Comments Share icon Share
a year
Posting as :
works at
You are currently posting as works at
Posting as :
a Senior Vice President 1
You are currently posting as Senior Vice President 1
I GOT AN OFFER FOR A DISTINGUISHING ML ENGINEER ROLE THAT WAS EXECUTIVE LEVEL
EVEN THOUGH IT WAS INDIVIDUAL CONTRIBUTOR AND THE COMP WAS $300K FOR THIS ENTRY
EXEC ROLE. I HAVE SEEN OTHERS CALL THEIR DIRECTOR TITLE’S EXECUTIVE AS WELL AS
US BANK.
IT ISN’T EXACTLY WHAT YOU ASKED BUT NOBODY ELSE IS ANSWERING
Like icon LikeReply
Share
1 reactionsa year
Posting as :
a Vice President 1
You are currently posting as Vice President 1
HAVE A SIMILAR QUESTION, BUT FOR VPS!
Like icon LikeReply
Share
a year
Posting as :
a Director 1
You are currently posting as Director 1
Bowl Leader
CHECK OUT THIS POST AND THE COMMENTS, YOU WILL FIND YOUR ANSWER HERE:
HTTPS://JOINFISHBOWL.COM/POST_77KEI6KTBM
What are the designation levels in the major finan
joinfishbowl.com
Like icon LikeReply
Share
a year
RELATED POSTS
Posting as :
works at L&T Technology Services Limited
▸ Design
You are currently posting as works at L&T Technology Services Limited
Hi i may have an offer from nagroo just wanted to know for embedded roles they
have wfh as hr said it is wfh. Will it stya that way for my profile or may
change after joining?
1 reactions
Like icon Like Comment icon 2 Comments Share icon Share
2Y
Posting as :
works at PwC
▸ Strategy
You are currently posting as works at PwC
What’s the salary of a senior consultant at Capgemini Invent for London location
in supply chain domain?
2 reactions
Like icon Like Comment icon 2 Comments Share icon Share
2Y
Posting as :
a Quality Assurance
▸ Engineering
You are currently posting as works at Quality Assurance
Hi Everyone on Saturday i gave interview for coforge . In how many days will i
get feedback.Coforge
2 reactions
Like icon Like Comment icon 7 Comments Share icon Share
2Y
Posting as :
a Senior Manager
▸ Other (non-Software)
You are currently posting as works at Senior Manager
Anyone here a US citizen who chose to leave in favor of London? I’m American but
husband is European. He wants to return for the social culture of Europe but I
just get traumatized by the pay in London and almost equally high cost of living
as in tier 1 USA cities. I know money isn’t everything but hoping to hear about
other Americans experiences . Thank you!
4 reactions
Like icon Like Comment icon 70 Comments Share icon Shares 6
3Y
Posting as :
works at Rsystems international
▸ Strategy
You are currently posting as works at Rsystems international
Hi fishes,
Please suggest what should I choose from following:
Mindtree -> 24 LPA (Following up every week if I am joining or not)
R Systems International -> 25 LPA (Current company, trying to retain, very
good hold on project and good relations with manager)
CCTC->18 LPA
Tech Stack -> Angular Front end development.
Serving notice period (more than 2 months left)
Please suggest considering the global recession fears
Thank you.
1 reactions
Like icon Like Comment icon 0 Comment Share icon Share
2Y
Posting as :
an Assistant Director
▸ Technology
You are currently posting as works at Assistant Director
Does anyone have a non-compete clause in their contract in the UK (restricting
you to work at a competitor firm)?
Do you know if Accenture enforces it at the time of exit?
1 reactions
Like icon Like Comment icon 8 Comments Share icon Share
a year
Posting as :
a Consultant
▸ Analytics
You are currently posting as works at Consultant
RFA M&A fishes 🐠 , how are the comp raises YoY?
2 reactions
Like icon Like Comment icon 0 Comment Share icon Share
3Y
Posting as :
a Manager
▸ Technology
You are currently posting as works at Manager
Community Builder
What salary would you say is needed to live comfortably in Dubai with the
following:
Married (single income)
Two kids (1 and 2 years old)
House in an expat community near good schools (4 bedroom)
Maid
2 reactions
Like icon Like Comment icon 3 Comments Share icon Share
2Y
Posting as :
a Manager
▸ Retail/Commercial
You are currently posting as works at Manager
Hello all recently applied for a position at Boeing. Application states it’s
under consideration. Is this a good thing? What’s the general turn around time
for a decision. How hard is it to usually get on? Boeing
3 reactions
Like icon Like Comment icon 1 Comment Share icon Share 1
2Y
Posting as :
works at EPIC Insurance Brokers & Consultants
▸ Advisors and Asset Managers
You are currently posting as works at EPIC Insurance Brokers & Consultants
I am wondering if anyone could recommend salary range for a private client
account manager at a high end broker. I have 6 years of agency experience (5 at
my current brokerage). I have a p&c license and a designation. Currently working
towards another designation. Thank you!
3 reactions
Like icon Like Comment icon 9 Comments Share icon Share 1
2Y
Posting as :
works at Wipro
▸ Operations
You are currently posting as works at Wipro
@Hi Fishes,
I am currently working with Wipro and was promoted in July as an Benefits
Operations Manager (This is Aon Hewitt taken over by Wipro) I have worked with
this company from past 6 years and my current CTC is 7 LPA. Can you suggest me
for openings in Operations/Benefits ?
Like icon Like Comment icon 0 Comment Share icon Share
2Y
Posting as :
a Manager
▸ Engineering
You are currently posting as works at Manager
My company is hiring for Sales Account Manager, if anyone is interested DM me.
14 reactions
Like icon Like Comment icon 20 Comments Share icon Share
a year
Posting as :
an Associate
You are currently posting as works at Associate
I'm a first year associate making 45k with possibility for high bonus, but I am
seriously considering leaving my firm because the posts in here have helped me
realize I am underpaid. Is it better to stay and get more experience - I do l
like where I am - or move on for a more livable salary and WLB?
5 reactions
Like icon Like Comment icon 14 Comments Share icon Share 1
2Y
Posting as :
an Associate Creative Director
▸ design
You are currently posting as works at Associate Creative Director
I fear one of my coworkers is underpaid. This person was hired for a different
role but is now doing a variety of work (account, PM, strategy, social mgmt, etc
etc) this person is very smart. (cont.)
1 reactions
Like icon Like Comment icon 5 Comments Share icon Share
4Y
Posting as :
works at JPMorgan Chase
▸ Other (non-Software)
You are currently posting as works at JPMorgan Chase
Does anyone know the salary band/TC for L5 business analyst at Amazon? Looking
to negotiate with HR this week.
1 reactions
Like icon Like Comment icon 2 Comments Share icon Share 1
2Y
Posting as :
works at PwC
▸ Financial Services
You are currently posting as works at PwC
If you’re interested in joining PwC’s consulting practice, feel free to reach
out. Happy to talk about current opportunities and offer a referral 😉
3 reactions
Like icon Like Comment icon 8 Comments Share icon Share
3Y
Posting as :
a Recruiting Coordinator
▸ Recruitment
You are currently posting as works at Recruiting Coordinator
I have some questions about Deloitte, if anybody is willing to offer some help.
I won’t ask for a referral
Thanks
1 reactions
Like icon Like Comment icon 12 Comments Share icon Share
2Y
Posting as :
works at Americold
You are currently posting as works at Americold
How much can you earn if you are really good at managing the supply chain? I'd
like to know how much you make starting out as well as your salary after a few
years, please
4 reactions
Like icon Like Comment icon 10 Comments Share icon Share 1
2Y
Posting as :
an Engineer
▸ Other (non-Software)
You are currently posting as works at Engineer
I need job advice. Currently a biotech development and tech transfer engineer in
the Boston area, but I need to move to NYC potentially and I’m thinking I’ll try
something new. I have some project management experience and some short
international work experiences (Japan and France), but I’ve mostly been a
laboratory based researcher.
Any ideas what type of job I could apply for? Need to make at least 120k/year
1 reactions
Like icon Like Comment icon 4 Comments Share icon Share 1
2Y
Posting as :
works at Cognizant
▸ Engineering
You are currently posting as works at Cognizant
How is work life balance at mastercard? And in terms of job security as i am
thinking not to switch soon again? I have around 9 years experience what max
salary they can offer for senior software engineer position? CCTC: 21 LPA
Mastercard
1 reactions
Like icon Like Comment icon 7 Comments Share icon Share
2Y
MORE POSTS
Posting as :
a Senior Legal Counsel
▸ Law
You are currently posting as works at Senior Legal Counsel
Used to be able to find Weller Special Reserve in Total for maybe $30 the
handle—a screaming bargain. Then it disappeared. Just dropped into a small
nearby shop where they had four of them on the shelf for $45. Maybe I should go
back and clear them out!
5 reactions
Like icon Like Comment icon 11 Comments Share icon Share
4Y
Posting as :
a Visual Designer
▸ Design
You are currently posting as works at Visual Designer
Trying to find a book maker/publication specialist to print a small run of
limited edition designer books. Was wondering if anyone has worked with vendors
that accommodate low MOQ and won’t completely break the bank? Looking to make
200-250 copies at the moment and any recommendations would help.
3 reactions
Like icon Like Comment icon 1 Comment Share icon Share 1
3Y
Posting as :
a Manager
▸ Advisory
You are currently posting as works at Manager
They went with another candidate. Excuse me while I spend the rest of today in
my feelings 😞
22 reactions
Like icon Like Comment icon 11 Comments Share icon Share
2Y
Posting as :
works at Otsuka America Pharmaceutical, Inc.
▸ Pharmacist
You are currently posting as works at Otsuka America Pharmaceutical, Inc.
Hello I'm looking for a remote role in consulting, medical writing, or medical
information. I'm a PharmD with a year of experience in pharma and ready to make
a change. If anyone can refer me or share any openings that are actively hiring
it would be appreciated.
2 reactions
Like icon Like Comment icon 2 Comments Share icon Share
a year
Posting as :
works at Lowes
▸ Restaurants & Food Service
You are currently posting as works at Lowes
Currently asking around for others that work in the hospitality industry
specifically banquets or banquet serving what is the tip pool break down at your
hotel servers,captain, houseman, house percentage do you think your paid fairly
from the tip pool?
Like icon Like Comment icon 0 Comment Share icon Share
2Y
Posting as :
works at SapientRazorfish
▸ creative
You are currently posting as works at SapientRazorfish
Hi Nadia thank you for doing this workshop my question is: how do you deal with
raging systemic bias and not get victimised by your line manager who is also a
group head ?
5 reactions
Like icon Like Comment icon 1 Comment Share icon Share
5Y
Posting as :
an Associate Attorney
▸ Law
You are currently posting as works at Associate Attorney
16 weeks and so worried all of the stress I’m under is going to hurt the baby.
Between work, my own scary (non-pregnancy) health stuff, the pandemic, my mom
(who is a widow and lives alone, basically isolated by choice due to covid) is
having health issues, and pressures to keep billable hours up, I’ve been having
complete breakdowns. Today I spent almost the entire day crying and now have to
make up the billable time this weekend. I really worry abt what effect this will
have on the babe.
2 reactions
Like icon Like Comment icon 3 Comments Share icon Share
3Y
Posting as :
attends University of Southern California
▸ Students
You are currently posting as attends University of Southern California
Graduating from part-time MBA in May, have been working as a product manager in
tech for 2 years and prior to that 5 years in BI/data analytics. I’m at a new
company now and I’m disliking PM more every day. I’m thinking about doing JIT
recruiting for investment banking to get strategic finance jobs in tech in 1-2
years but we’re having a baby in August. Is it stupid to try to pull off a pivot
like that? I value WLB and want to be able to take paternity leave when our
daughter is born
1 reactions
Like icon Like Comment icon 3 Comments Share icon Share
3Y
Posting as :
a Senior Consultant
▸ Technology
You are currently posting as works at Senior Consultant
Where can I buy treasury bonds? Can I do it through Fidelity? I tried searching
for bonds but nothing seemed to exactly match for bonds (plz don't laugh I'm
terribly new at this stuff lol)
Like icon Like Comment icon 3 Comments Share icon Share
4Y
Posting as :
an Audit Associate
▸ Audit
You are currently posting as works at Audit Associate
For Denver Co, what are the main industries for audit?
1 reactions
Like icon Like Comment icon 3 Comments Share icon Share
3Y
Posting as :
works at Capgemini
▸ Other
You are currently posting as works at Capgemini
Hi Guys,
I have been extended an offer letter for the level - Associate in Risk advisory.
Below is the ss of my comp, request you to help me understand if it's the
appropriate compensation for an Associate in pwc.
2 reactions
Like icon Like Comment icon 6 Comments Share icon Share
a year
Posting as :
a Strategy Consultant
▸ strategy
You are currently posting as works at Strategy Consultant
Hey fish, if you haven’t tried it, I recommend researching ketamine treatments
for depression. I just started and it’s making a huge difference. I’ve been on
SSRIs for years and other drugs and nothing has made a dent but ketamine
3 reactions
Like icon Like Comment icon 10 Comments Share icon Shares 2
4Y
Posting as :
a Manager
▸ advisory
You are currently posting as works at Manager
Sharing some positive news. Got my I 140 approved today in EB2. Even though the
wait is forever. Sending out positive vibes. Happy Friday folks!
11 reactions
Like icon Like Comment icon 14 Comments Share icon Share
5Y
Posting as :
a Senior Consultant
▸ Advisory
You are currently posting as works at Senior Consultant
If I sign a lease with room mates, say 3, but I want to leave instead of renew
next, what happens at the end of the lease? Do I need to find someone to replace
me? Or do the people staying find the new person.
1 reactions
Like icon Like Comment icon 6 Comments Share icon Share
3Y
Posting as :
a Healthcare Associate
▸ healthcare
You are currently posting as works at Healthcare Associate
Hey McKinsey Fish! Is there any real luck of applying to a job on the website? I
applied to an implementation role that I know I would be qualified for but
without any referral. Been a few weeks so was just hoping to atleast see a
rejection 😁
1 reactions
Like icon Like Comment icon 3 Comments Share icon Share
4Y
Posting as :
a Lead
▸ Technology
You are currently posting as works at Lead
Pro
Men - when you say it’s not working out to your SO, are you trying to initiate a
conversation on reasons / things you’d like to change OR trying to end it?
2 reactions
Like icon Like Comment icon 9 Comments Share icon Share
2Y
Posting as :
works at Sunglass Hut
▸ Customer Service
You are currently posting as works at Sunglass Hut
How much a year should I ask for managing two Sunglass Huts in the same mall one
stand alone store one in Hudson’s bay.
1 reactions
Like icon Like Comment icon 4 Comments Share icon Share
2Y
Posting as :
works at JPMorgan Chase
▸ Engineering
You are currently posting as works at JPMorgan Chase
Pro
Those who are on NP
Please send me your CV @ referforthebest@gmail.com with details in the subject
line Name_YOE_TECHSTACK_ROLE_LOCATION_NP. I request you to please follow the
format.
4 reactions
Like icon Like Comment icon 4 Comments Share icon Share
2Y
Posting as :
a Cyber Security Consultant
▸ advisory
You are currently posting as works at Cyber Security Consultant
Booz Allen or Deloitte better for Cyber?
1 reactions
Like icon Like Comment icon 4 Comments Share icon Share
4Y
Posting as :
a Designer
▸ Graphic/Ux Design
You are currently posting as works at Designer
What are some smart things to talk about during interview with UX director? Or
what type of ux questions should I expect? I'm visual designer interviewing for
product design..
Like icon Like Comment icon 4 Comments Share icon Share 1
6Y
ADDITIONAL POSTS IN US BANKING SALARIES & DESIGNATIONS
Posting as :
an Analyst
▸ Venture Capital
You are currently posting as works at Analyst
Does anyone know the TC (range is okay) for investment analysts/associates at
ARK Investment Management? Any other feedback from people you know who work
there?
2 reactions
Like icon Like Comment icon 1 Comment Share icon Share
2Y
Posting as :
a Compliance Manager
▸ Retail/Commercial
You are currently posting as works at Compliance Manager
Capital one offer extended & accepted. Background check is complete and marked
as “eligible” by the background check company. It was delivered to Cap1 2 days
ago. Shouldn’t I have heard back by now? I’m waiting to get info on my start
date and equipment etc. Should I reach out?
2 reactions
Like icon Like Comment icon 1 Comment Share icon Share
2Y
Posting as :
a Director
▸ Other (non-Software)
You are currently posting as works at Director
Bowl Leader
Welcome everyone! This bowl is intended to inform those working in the banking
industry in the US regarding salary ranges and designation levels. Let’s help
each other out, and let’s please be kind to one another.
2 reactions
Like icon Like Comment icon 0 Comment Share icon Share
2Y
Posting as :
a Senior Operations Specialist
▸ Retail/Commercial
You are currently posting as works at Senior Operations Specialist
I went through two rounds of interviews for
a job that the posting stated $36.66 per
hour (FP&A Analyst)…the company
recruiter had told me in the initial call the
pay could be 32-36 because of the other
benefits. If I do get a job offer what range
should I try for? I was really hoping to get
around the 36-40 but now I feel like they
may try to offer lower than what was
posted. Also there was no range but the
average for this position is upper 70s-90k.
Thanks for any help!
1 reactions
Like icon Like Comment icon 0 Comment Share icon Share
2Y
Posting as :
a Director
▸ Other (non-Software)
You are currently posting as works at Director
Bowl Leader
Add a comment with the designation levels in your bank.
1 reactions
Like icon Like Comment icon 3 Comments Share icon Shares 2
2Y
Posting as :
a Business Development Consultant
▸ Sales
You are currently posting as works at Business Development Consultant
Fishbowl family… any UBS financial advisor training program here? What is the
total expected income? My friend was offered 55k as base plus bonus…
2 reactions
Like icon Like Comment icon 6 Comments Share icon Share
2Y
Posting as :
a Software Engineer
▸ Other
You are currently posting as works at Software Engineer
Hi all, I’m not sure if this is the correct bowl to post in but could anyone
that works at Truist Financial Corporation look up the salary range for their
Intelligent Automation Product Owner - Agile role?
Like icon Like Comment icon 1 Comment Share icon Share
2Y
Posting as :
a Consultant
▸ Strategy
You are currently posting as works at Consultant
May I know the grading within Standard Chartered? I am applying for a job in
branding and communication at SC UK
I am confused by the title, like Associate, Manager, Associate Director and
Director.
And also, the salary range between Associate and Associate Director is so close.
What is the market range in the banking industry in the UK?
1 reactions
Like icon Like Comment icon 2 Comments Share icon Share
2Y
Posting as :
a Vice President
▸ Retail/Commercial
You are currently posting as works at Vice President
I'm a VP at Union Bank, which just got acquired by US Bank. I work in
quantitative analysis. I think by salary is a bit below market for a VP ($120K).
Obviously I'd love to make more. Have those of you at heard of any discussions
about raises?
Separately, what is a normal salary for that role at US Bank?
2 reactions
Like icon Like Comment icon 4 Comments Share icon Shares 2
a year
NEW TO FISHBOWL?
Download the Fishbowl app to
unlock all discussions on Fishbowl.
Download now
NEW TO FISHBOWL?
Sign up in seconds to unlock all discussions on Fishbowl.
"" is an unusual email domain. If correct, please proceed to the next step
Enter work email
By continuing you acknowledge our Terms of Use and Privacy Policy
Messaging rates may apply Submit
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of
Service apply.
TRENDING TOPICS
Refresh icon
Certifications - CMA discussions
Chevron icon
Business Transformation Consultant Jobs discussions
Chevron icon
Certifications - PCA discussions
Chevron icon
Managing Partner Layoffs discussions
Chevron icon
Finance Layoffs discussions
Chevron icon
Senior Auditor Layoffs discussions
Chevron icon
Associate Consultant Layoffs discussions
Chevron icon
Advertising Salary discussions
Chevron icon
Strategist Jobs discussions
Chevron icon
Books on marketing discussions
Chevron icon
* Posts
* Can-anyone-shed-light-on-the-job-hierarchy-at-u-s-bank-associatedirectorvp-i-am-trying-to-understand-the-hierarchy-of-the
Real talk with other professionals
Follow Fishbowl on InstagramInstagram iconFollow Fishbowl on TwitterTwitter
iconFollow Fishbowl on LinkedinLinkedin iconFollow Fishbowl on FacebookFacebook
icon
Follow Fishbowl on InstagramInstagram iconFollow Fishbowl on TwitterTwitter
iconFollow Fishbowl on LinkedinLinkedin iconFollow Fishbowl on FacebookFacebook
icon
Insights
About
Students
Careers
Community Guidelines
FAQ
Terms of Use (New)
Privacy Policy (New)
Press
Newsletters
Directory
Live Events
Cookie Consent Tool
Do Not Sell or Share My Personal Information
Copyright © Glassdoor LLC "Fishbowl" and logo are registered trademarks of
Glassdoor LLC
That was just a preview…
Sign Up to see all discussions
* Discover what it’s like to work at companies from real professionals
* Get candid advice from people in your field in a safe space
* Chat and network with other professionals in your field
Close icon
Sign up in seconds to unlock all discussions on Fishbowl.
"" is an unusual email domain. If correct, please proceed to the next step
Enter work email
By continuing you acknowledge our Terms of Use and Privacy Policy
Messaging rates may apply Submit
This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of
Service apply.
Already a user?
Login here
NEW TO FISHBOWL?
Download the Fishbowl app to unlock all discussions on Fishbowl.
Download now
Share
* Share to Twitter
* Share to Linkedin
* Share to Facebook
* Copy link Link Copied
* Copy Embed
* Share via Email
* Share to Slack
EMBED THIS POST
Close icon
Copy Code
Copy and paste embed code on your site
Preview
Close icon
DOWNLOAD THE
FISHBOWL APP
See what’s happening in your industry
from the palm of your hand.
Send download link to your phone
OR
Scan your QR code to download
Fishbowl app on your mobile
ADAEAFAGAIALAMAOAQARASATAUAWAXAZBABBBDBEBFBGBHBIBJBLBMBNBOBQBRBSBTBVBWBYBZCACCCDCFCGCHCICKCLCMCNCOCRCVCWCXCYCZDEDJDKDMDODZECEEEGEHERESETFIFJFKFMFOFRGAGBGDGEGFGGGHGIGLGMGNGPGQGRGSGTGUGWGYHKHMHNHRHTHUIDIEILIMINIOIQISITJEJMJOJPKEKGKHKIKMKNKRKWKYKZLALBLCLILKLRLSLTLULVLYMAMCMDMEMFMGMHMKMLMMMNMOMPMQMRMSMTMUMVMWMXMYMZNANCNENFNGNINLNONPNRNUNZOMPAPEPFPGPHPKPLPMPNPRPSPTPWPYQARERORSRURWSASBSCSESGSHSISJSKSLSMSNSOSRSSSTSVSXSZTCTDTFTGTHTJTKTLTMTNTOTRTTTVTWTZUGUMUSUYUZVAVCVEVGVIVNVUWFWSXKYEYTZAZMZW
+1
Phone number
Please enter a valid number
Send Link
By continuing you agree to Terms of Use and Privacy Policy.
Messaging rates may apply
Close icon
SIGN UP FOR FREE TO VIEW THIS CONVERSATION ON FISHBOWL
By continuing you acknowledge our Terms of Use and Privacy Policy
"" is an unusual email domain. If correct, please proceed to the next step
Work Email
Why work email
Info icon
* Participate in safe communities with other verified professionals.
* Candidly discuss workplace matters in company exclusive channels and group
chats.
* Flexible identity preferences allows honest conversations with other
colleagues.
Click here if you do not want to receive marketing emails from Fishbowl and
affiliates
Sign Up
We’re experiencing delivery issues to that domain.
Please choose one of the options
--------------------------------------------------------------------------------
Continue with Google Continue with Linkedin
Already have an account? Log in
SIGN UP FOR FREE TO CONTINUE USING FISHBOWL
By continuing you acknowledge our Terms of Use(New) and Privacy Policy(New)
Messaging rates may apply
"" is an unusual email domain. If correct, please proceed to the next step
Work Email
Why work email
Info icon
* Participate in safe communities with other verified professionals.
* Candidly discuss workplace matters in company exclusive channels and group
chats.
* Flexible identity preferences allows honest conversations with other
colleagues.
Click here if you do not want to receive marketing emails from Fishbowl and
affiliates
Sign Up
We’re experiencing delivery issues to that domain.
Please choose one of the options
--------------------------------------------------------------------------------
Continue with Google Continue with Linkedin
Already have an account? Log in
FOR ACCOUNT SETTINGS, VISIT FISHBOWL ON DESKTOP BROWSER OR
AppStore icon
App Store
Android icon
Google Play
GENERAL
Send Feedback Like Fishbowl on Facebook Follow Fishbowl on Instagram Follow
Fishbowl on Twitter Sign out
LEGAL
FAQPrivacy Policy (New)Terms of Service (New)
Please wait
We use first and third-party cookies on our platform (including strictly
necessary; analysis and user experience improvement; and ad personalization and
effectiveness cookies). To agree to these cookies for these purposes, please
Accept Cookies. Learn more in our Cookie Policy. Change your choices via Select
Cookies or the Cookie Consent Tool in our footer.
Select Cookies Accept Cookies
PRIVACY PREFERENCE CENTER
When you visit any website, it may store or retrieve information on your
browser, mostly in the form of cookies. This information might be about you,
your preferences or your device and is mostly used to make the site work as you
expect it to. The information does not usually directly identify you, but it can
give you a more personalized web experience. Because we respect your right to
privacy, you can choose not to allow some types of cookies. Click on the
different category headings to find out more and change our default settings.
However, blocking some types of cookies may impact your experience of the site
and the services we are able to offer.
More information
Accept All Cookies
MANAGE CONSENT PREFERENCES
FUNCTIONAL COOKIES
Functional Cookies
These cookies enable the website to provide enhanced functionality and
personalization. They may be set by us or by third party providers whose
services we have added to our pages. If you do not allow these cookies then
some or all of these services may not function properly.
Cookies Details
STRICTLY NECESSARY COOKIES
Always Active
These cookies are necessary for the website to function and cannot be switched
off in our systems. They are usually only set in response to actions made by you
which amount to a request for services, such as setting your privacy
preferences, logging in or filling in forms. You can set your browser to
block or alert you about these cookies, but some parts of the site will not then
work. These cookies do not store any personally identifiable information. Due to
the technical complexities of cookie scanning technology, the below may not be
an exhaustive list, but is as thorough as practicably possible. Opting out of
this type of cookie will block all cookies of this type regardless of their
inclusion in the list below.
Cookies Details
ANALYTICS COOKIES
Analytics Cookies
These cookies allow us to count visits and traffic sources so we can measure and
improve the performance of our site. They help us to know which pages are the
most and least popular and see how visitors move around the site. All
information these cookies collect is aggregated and therefore anonymous. If you
do not allow these cookies we will not know when you have visited our site, and
will not be able to monitor its performance.
Cookies Details
TARGETING COOKIES
Targeting Cookies
These cookies may be set through our site by our advertising partners. They may
be used by those companies to build a profile of your interests and show you
relevant adverts on other sites. They do not store directly personal
information, but are based on uniquely identifying your browser and internet
device. If you do not allow these cookies, you will experience less targeted
advertising.
Cookies Details
OPTIONAL COOKIES
Optional Cookies
These cookies include those that 1) enable the website to provide enhanced
functionality and personalization (Functional Cookies); 2) allow us to count
visits and traffic sources so we can measure and improve the performance of our
site (Analytics Cookies); and 3) may be set through our site by our advertising
partners (Targeting Cookies). All three types may be set by us or by third party
providers whose services we have added to our pages. If you do not allow some of
these cookies then some of these services may not function properly. In some
cases, these cookies do not store directly personal information, but are based
on uniquely identifying your browser and internet device, and in other cases
data is collected and aggregated and is therefore anonymous. Due to the
technical complexities of cookie scanning technology, the below may not be an
exhaustive list, but is as thorough as practicably possible. Opting out of this
type of cookie will block all cookies of this type regardless of their inclusion
in the list below.
Cookies Details
Back Button
PERFORMANCE COOKIES
Search Icon
Filter Icon
Clear
checkbox label label
Apply Cancel
Consent Leg.Interest
checkbox label label
checkbox label label
checkbox label label
*
View Cookies
* Name
cookie name
Confirm My Choices