store1.fwscart.com
Open in
urlscan Pro
52.19.39.5
Public Scan
URL:
https://store1.fwscart.com/product/christmas-gift-new-firefly-338-bl-guitar-semi-hollow-body-electric-guitar-blue
Submission: On December 22 via manual from US — Scanned from DE
Submission: On December 22 via manual from US — Scanned from DE
Form analysis 2 forms found in the DOM
GET https://store1.fwscart.com/index.aspx?pageid=rtxm9
<form action="https://store1.fwscart.com/index.aspx?pageid=rtxm9" method="get"><input name="pageid" id="pageid" type="hidden" value="rtxm9"><input name="chainID" id="chainID" type="hidden" value="801351">
<div class="search" data-editor-type="search">
<div class="search_container">
<input type="text" id="txtQuickSearch" name="txtQuickSearch" placeholder="search" aria-label="product search">
<button aria-label="search"><i class="fas fa-search" aria-hidden="true"></i></button>
<div id="search_container_close"><i class="fas fa-times" aria-hidden="true"></i></div>
</div>
</div>
</form>POST https://store1.fwscart.com/sidebysidecartview.aspx?xid=53mhucm2y3mqodz2smoqu4dq&action=add&prodid=35272103
<form id="form_post_basket" action="https://store1.fwscart.com/sidebysidecartview.aspx?xid=53mhucm2y3mqodz2smoqu4dq&action=add&prodid=35272103" method="post" onsubmit="return true;">
<input type="hidden" id="prodid" name="prodid" value="35272103">
<input type="hidden" id="action" name="action" value="add">
<input type="hidden" id="variantid" name="variantid" value="">
<div id="details">
<div id="details_left">
<div id="details_images" data-editor-type="product-images">
<div id="details_images_main">
<picture>
<source id="main_product_image_webp" srcset="//cdn.freewebstore.com/origin/801351/000021_1703255439287.jpg?webp=1" type="image/webp">
<img data-src="//cdn.freewebstore.com/origin/801351/000021_1703255439287.jpg" id="main_product_image" class=" ls-is-cached lazyloaded" alt="Christmas gift New Firefly 338 BL Guitar Semi-Hollow Body Electric Guitar (Blue)"
src="//cdn.freewebstore.com/origin/801351/000021_1703255439287.jpg">
</picture>
</div>
<div id="details_images_extra">
<div class="details_images_extra_item details_images_extra_item_selected">
<picture>
<source srcset="//cdn.freewebstore.com/origin/801351/000021_1703255439287.jpg?webp=1" type="image/webp">
<img data-src="//cdn.freewebstore.com/origin/801351/000021_1703255439287.jpg" class="details_images_extra_item_image ls-is-cached lazyloaded" alt="Christmas gift New Firefly 338 BL Guitar Semi-Hollow Body Electric Guitar (Blue)"
src="//cdn.freewebstore.com/origin/801351/000021_1703255439287.jpg">
</picture>
</div>
<div class="details_images_extra_item">
<picture>
<source srcset="https://cdn.freewebstore.com/origin/801351/00002_1703256101610.jpg" type="image/webp">
<img data-src="https://cdn.freewebstore.com/origin/801351/00002_1703256101610.jpg" class="details_images_extra_item_image ls-is-cached lazyloaded" alt="Christmas gift New Firefly 338 BL Guitar Semi-Hollow Body Electric Guitar (Blue)"
src="https://cdn.freewebstore.com/origin/801351/00002_1703256101610.jpg">
</picture>
</div>
<div class="details_images_extra_item">
<picture>
<source srcset="https://cdn.freewebstore.com/origin/801351/000023_1703256119274.jpg" type="image/webp">
<img data-src="https://cdn.freewebstore.com/origin/801351/000023_1703256119274.jpg" class="details_images_extra_item_image ls-is-cached lazyloaded" alt="Christmas gift New Firefly 338 BL Guitar Semi-Hollow Body Electric Guitar (Blue)"
src="https://cdn.freewebstore.com/origin/801351/000023_1703256119274.jpg">
</picture>
</div>
<div class="details_images_extra_item">
<picture>
<source srcset="https://cdn.freewebstore.com/origin/801351/000024_1703256128980.jpg" type="image/webp">
<img data-src="https://cdn.freewebstore.com/origin/801351/000024_1703256128980.jpg" class="details_images_extra_item_image ls-is-cached lazyloaded" alt="Christmas gift New Firefly 338 BL Guitar Semi-Hollow Body Electric Guitar (Blue)"
src="https://cdn.freewebstore.com/origin/801351/000024_1703256128980.jpg">
</picture>
</div>
</div>
</div>
</div>
<div id="details_right">
<h1 id="details_title" data-editor-type="product-name">Christmas gift New Firefly 338 BL Guitar Semi-Hollow Body Electric Guitar (Blue)</h1>
<div id="details_code"><strong data-lang="Product Code">Product Code</strong><span>: 285571705913</span></div>
<div id="details_price" data-editor-type="product-price">
<div id="details_price_main">
<div class="price_breakdown">
<div class="price_inc_tax" id="ui_price_inc_tax">$471.00</div>
</div>
</div>
</div>
<div id="details_add_to_cart" data-editor-type="product-cart">
<div id="details_buy">
<div id="details_buy_quantity">
<input type="number" name="txtQty" id="txtQty" maxlength="12" value="1" title="Quantity:" class="input-text qty">
<div id="details_buy_quantity_buttons">
<button onclick="var result = document.getElementById('txtQty'); var txtQty = result.value; if( !isNaN( txtQty )) result.value++;return false;" class="increase items-count-increased"
type="button"><i class="fa fa-angle-up" aria-hidden="true"></i></button>
<button onclick="var result = document.getElementById('txtQty'); var txtQty = result.value; if( !isNaN( txtQty ) && txtQty > 0 ) result.value--;return false;" class="reduced items-count-reduced"
type="button"><i class="fa fa-angle-down" aria-hidden="true"></i></button>
</div>
</div>
<a href="javascript:void(0);" onclick="javascript:AddToBasket();" id="details_buy_button"><i class="fas fa-plus" aria-hidden="true"></i> <span data-lang="Add to Cart">Add to Cart</span></a>
</div>
</div>
<div style="max-width: 300px;">
</div>
<div id="wishlist_not_logged_in_html" class="wishlist_container">
<a onclick="addToWishlistLogin()" title="Add To Wishlist">
<strong data-lang="Add To Wishlist">Add To Wishlist</strong>
<svg xmlns="http://www.w3.org/2000/svg" fill="none" viewBox="0 0 24 24">
<path stroke-linecap="round" stroke-linejoin="round" stroke-width="2" d="M4.318 6.318a4.5 4.5 0 000 6.364L12 20.364l7.682-7.682a4.5 4.5 0 00-6.364-6.364L12 7.636l-1.318-1.318a4.5 4.5 0 00-6.364 0z"></path>
</svg>
</a>
</div>
<script>
$(document).ready(function() {
$('#share_facebook').attr("href", "http://www.facebook.com/sharer/sharer.php?u=" + window.location.href);
$('#share_pinterest').attr("href", "http://pinterest.com/pin/create/button/?url=" + window.location.href + '&media=' + base_product_img_full);
$('#share_twitter').attr("href", "http://twitter.com/intent/tweet?url=" + window.location.href);
});
</script>
<div id="share_panel" data-editor-type="social-share-icons">
<div id="share_panel_text">Share</div>
<div id="share_panel_icons">
<a id="share_facebook" class="share_panel_icons_item" onclick="window.open(this.href, 'mywin','left=20,top=20,width=500,height=500,toolbar=0,resizable=0,tabbar=0'); return false;" href="http://www.facebook.com/sharer/sharer.php?u=https://store1.fwscart.com/product/christmas-gift-new-firefly-338-bl-guitar-semi-hollow-body-electric-guitar-blue">
<i class="fab fa-facebook-f" aria-hidden="true"></i>
</a>
<a id="share_twitter" class="share_panel_icons_item" onclick="window.open(this.href, 'mywin','left=20,top=20,width=500,height=500,toolbar=0,resizable=0,tabbar=0'); return false;" href="http://twitter.com/intent/tweet?url=https://store1.fwscart.com/product/christmas-gift-new-firefly-338-bl-guitar-semi-hollow-body-electric-guitar-blue">
<i class="fab fa-twitter" aria-hidden="true"></i>
</a>
<a id="share_pinterest" class="share_panel_icons_item" onclick="window.open(this.href, 'mywin','left=20,top=20,width=500,height=500,toolbar=0,resizable=0,tabbar=0'); return false;" href="http://pinterest.com/pin/create/button/?url=https://store1.fwscart.com/product/christmas-gift-new-firefly-338-bl-guitar-semi-hollow-body-electric-guitar-blue&media=//cdn.freewebstore.com/origin/801351/000021_1703255439287.jpg">
<i class="fab fa-pinterest-p" aria-hidden="true"></i>
</a>
</div>
</div>
</div>
</div>
<div id="the_description"><span style="font-size: 24px;"><strong>The Blue Burst Firefly semi-hollow body guitar has Twin humbuckers for the Rock and power sound, 2 Volume & 2 Tone, Set-In neck, Separate adjustable bridge and
tailpiece.</strong></span><br><br><span style="font-size: 24px;"><strong>Features & details:</strong></span><br><br><span style="font-size: 24px;"><strong>• Semi-acoustic, double cutaway body with 'f' holes, Set-in
Neck</strong></span><br><span style="font-size: 24px;"><strong>• Full Scale Electric Guitar with Nickel strings and Bone nut</strong></span><br><span style="font-size: 24px;"><strong>• 2V&2T, 2XChrome Humbucker
pickups</strong></span><br><span style="font-size: 24px;"><strong>Chrome Hardware, Adjustable Tune-o-matic Bridge</strong></span><br><span style="font-size: 24px;"><strong>with 10 FT cable, and Picks</strong></span><br><span
style="font-size: 24px;"><strong>• Back/Body Material: Maple</strong></span><br><br><span style="font-size: 24px;"><strong>Includes:</strong></span><br><span style="font-size: 24px;"><strong>• Guitar with nickel strings and bone
nut</strong></span><br><span style="font-size: 24px;"><strong>• 10 FT Professional instrument cable</strong></span><br><span style="font-size: 24px;"><strong>• 10 guitar picks with the thickness of 0.46mm, 0.71mm and 0.81mm<br><br><img
src="https://cdn.freewebstore.com/origin/801351/00002_1703256249260.jpg" alt=""><br><br><img src="https://cdn.freewebstore.com/origin/801351/000021_1703256282654.jpg" alt=""><br><br><img
src="https://cdn.freewebstore.com/origin/801351/000023_1703256318710.jpg" alt=""><br><br><img src="https://cdn.freewebstore.com/origin/801351/000024_1703256355152.jpg" alt=""><br><br>Order bow<br>to get your new gift and enjoy<br>thank
you<br><br><br></strong></span></div>
<div id="product_details">
<div id="product_details_item_code" class="product_details_item"><strong data-lang="Product Code">Product Code</strong><span>: 285571705913</span></div>
<div id="product_details_item_condition" class="product_details_item"><strong data-lang="Product Condition">Product Condition</strong><span>: New</span></div>
</div>
</form>Text Content
USD AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL Menu HomeProducts & ServicesAboutCartContactOffers Store CameratoolsFurnitureElectronicsSportsDecorationOthersservices Welcome to store1 Sign In USD AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL HomeProducts & ServicesAboutCartContactOffers Store CameratoolsFurnitureElectronicsSportsDecorationOthersservices 0 $0.00 * Store * Others CHRISTMAS GIFT NEW FIREFLY 338 BL GUITAR SEMI-HOLLOW BODY ELECTRIC GUITAR (BLUE) Product Code: 285571705913 $471.00 Add to Cart Add To Wishlist Share The Blue Burst Firefly semi-hollow body guitar has Twin humbuckers for the Rock and power sound, 2 Volume & 2 Tone, Set-In neck, Separate adjustable bridge and tailpiece. Features & details: • Semi-acoustic, double cutaway body with 'f' holes, Set-in Neck • Full Scale Electric Guitar with Nickel strings and Bone nut • 2V&2T, 2XChrome Humbucker pickups Chrome Hardware, Adjustable Tune-o-matic Bridge with 10 FT cable, and Picks • Back/Body Material: Maple Includes: • Guitar with nickel strings and bone nut • 10 FT Professional instrument cable • 10 guitar picks with the thickness of 0.46mm, 0.71mm and 0.81mm Order bow to get your new gift and enjoy thank you Product Code: 285571705913 Product Condition: New Updating Order Details Please do not refresh or navigate away from the page! Description Product Details Reviews The Blue Burst Firefly semi-hollow body guitar has Twin humbuckers for the Rock and power sound, 2 Volume & 2 Tone, Set-In neck, Separate adjustable bridge and tailpiece. Features & details: • Semi-acoustic, double cutaway body with 'f' holes, Set-in Neck • Full Scale Electric Guitar with Nickel strings and Bone nut • 2V&2T, 2XChrome Humbucker pickups Chrome Hardware, Adjustable Tune-o-matic Bridge with 10 FT cable, and Picks • Back/Body Material: Maple Includes: • Guitar with nickel strings and bone nut • 10 FT Professional instrument cable • 10 guitar picks with the thickness of 0.46mm, 0.71mm and 0.81mm Order bow to get your new gift and enjoy thank you Product Code: 285571705913 Product Condition: New No Reviews Posted Yet - be the first! write review © 2023. store1Free Stripe store Store Links TermsPrivacySitemap Newsletter Subscribe Product Added to your Cart x proceed to checkout -------- OR -------- continue shopping continue shopping MODAL DIALOG TITLE Modal Dialog Content Cancel Ok Create a free online store Powered by freewebstore.com Get your free online store today - Be your own boss! freewebstore Got a great business idea? Get a free online store just like this one! What do I get? Fully loaded webstore Unlimited products Domain & SSL checkout 24/7 support And more... Why freewebstore? 15+ years 1 million stores created No card required Easy to create What's the catch? Nope, no catch 0% commission Free forever! Premium upgrades available Get Started i ? Free Websites - click here freewebstore