jahnaviwithsaathwiksamala.appvideo.fcliveevents.in Open in urlscan Pro
216.219.95.231 Public Scan

Go To Rescan
Add Verdict Report

URL:
https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Submission: On March 30 via api (March 30th 2024, 1:16:40 am UTC) from US — Scanned from US

Summary HTTP 82 Redirects Links 1 Behaviour Indicators

Summary

This website contacted 43 IPs in 5 countries across 37 domains to perform 82 HTTP transactions. The main IP is 216.219.95.231, located in United States and belongs to IS-AS-1, US. The main domain is jahnaviwithsaathwiksamala.appvideo.fcliveevents.in.
TLS certificate: Issued by R3 on March 29th 2024. Valid for: 3 months.

This is the only time jahnaviwithsaathwiksamala.appvideo.fcliveevents.in was scanned on urlscan.io!

urlscan.io Verdict: No classification

Domain & IP information

	IP Address	AS Autonomous System
9	216.219.95.231 216.219.95.231	19318 (IS-AS-1) (IS-AS-1)
14	2600:9000:220... 2600:9000:2209:c000:1f:8466:d380:21	16509 (AMAZON-02) (AMAZON-02)
2	2607:f8b0:400... 2607:f8b0:4002:c0f::61	15169 (GOOGLE) (GOOGLE)
1	2606:4700:10:... 2606:4700:10::6814:4373	13335 (CLOUDFLAR...) (CLOUDFLARENET)
2	5.75.143.77 5.75.143.77	24940 (HETZNER-AS) (HETZNER-AS)
1	149.56.240.127 149.56.240.127	16276 (OVH) (OVH)
2	2001:4860:480... 2001:4860:4802:32::178	15169 (GOOGLE) (GOOGLE)
1	2001:4860:480... 2001:4860:4802:32::181	15169 (GOOGLE) (GOOGLE)
2	2607:f8b0:400... 2607:f8b0:4002:c1b::9d	15169 (GOOGLE) (GOOGLE)
3	2606:4700:21:... 2606:4700:21::8d65:780b	13335 (CLOUDFLAR...) (CLOUDFLARENET)
1	64.233.185.99 64.233.185.99	15169 (GOOGLE) (GOOGLE)
1	18.238.55.22 18.238.55.22	16509 (AMAZON-02) (AMAZON-02)
2	3.19.195.77 3.19.195.77	16509 (AMAZON-02) (AMAZON-02)
1	172.64.153.173 172.64.153.173	13335 (CLOUDFLAR...) (CLOUDFLARENET)
2	18.173.132.31 18.173.132.31	16509 (AMAZON-02) (AMAZON-02)
1	67.202.105.32 67.202.105.32	32748 (STEADFAST) (STEADFAST)
1	23.198.214.73 23.198.214.73	20940 (AKAMAI-ASN1) (AKAMAI-ASN1)
1	67.202.105.31 67.202.105.31	32748 (STEADFAST) (STEADFAST)
1	23.198.214.81 23.198.214.81	20940 (AKAMAI-ASN1) (AKAMAI-ASN1)
1	108.139.29.87 108.139.29.87	16509 (AMAZON-02) (AMAZON-02)
1	104.18.35.167 104.18.35.167	13335 (CLOUDFLAR...) (CLOUDFLARENET)
1 2	67.202.105.23 67.202.105.23	32748 (STEADFAST) (STEADFAST)
3 4	35.244.154.8 35.244.154.8	15169 (GOOGLE) (GOOGLE)
2 2	34.98.64.218 34.98.64.218	396982 (GOOGLE-CL...) (GOOGLE-CLOUD-PLATFORM)
2	34.86.110.8 34.86.110.8	396982 (GOOGLE-CL...) (GOOGLE-CLOUD-PLATFORM)
2	107.178.254.65 107.178.254.65	396982 (GOOGLE-CL...) (GOOGLE-CLOUD-PLATFORM)
2	108.138.128.34 108.138.128.34	16509 (AMAZON-02) (AMAZON-02)
1	2606:4700:20:... 2606:4700:20::681a:d3c	13335 (CLOUDFLAR...) (CLOUDFLARENET)
2 2	141.94.171.214 141.94.171.214	16276 (OVH) (OVH)
1 2	23.37.233.35 23.37.233.35	16625 (AKAMAI-AS) (AKAMAI-AS)
3 3	173.194.219.156 173.194.219.156	15169 (GOOGLE) (GOOGLE)
2 3	52.3.41.35 52.3.41.35	14618 (AMAZON-AES) (AMAZON-AES)
1	44.209.254.124 44.209.254.124	14618 (AMAZON-AES) (AMAZON-AES)
1	13.226.34.99 13.226.34.99	16509 (AMAZON-02) (AMAZON-02)
3 3	3.224.87.131 3.224.87.131	14618 (AMAZON-AES) (AMAZON-AES)
2 2	108.138.106.51 108.138.106.51	16509 (AMAZON-02) (AMAZON-02)
1 1	199.38.167.130 199.38.167.130	54312 (ROCKETFUEL) (ROCKETFUEL)
1 2	2620:1ec:21::14 2620:1ec:21::14	8068 (MICROSOFT...) (MICROSOFT-CORP-MSN-AS-BLOCK)
1 1	35.194.66.159 35.194.66.159	396982 (GOOGLE-CL...) (GOOGLE-CLOUD-PLATFORM)
3	3.235.217.129 3.235.217.129	14618 (AMAZON-AES) (AMAZON-AES)
1	18.238.55.108 18.238.55.108	16509 (AMAZON-02) (AMAZON-02)
1 2	54.234.166.1 54.234.166.1	14618 (AMAZON-AES) (AMAZON-AES)
6	50.16.174.192 50.16.174.192	14618 (AMAZON-AES) (AMAZON-AES)
1	172.67.163.146 172.67.163.146	13335 (CLOUDFLAR...) (CLOUDFLARENET)
1	108.138.128.28 108.138.128.28	16509 (AMAZON-02) (AMAZON-02)
1 1	15.197.193.217 15.197.193.217	16509 (AMAZON-02) (AMAZON-02)
2 2	34.200.65.202 34.200.65.202	14618 (AMAZON-AES) (AMAZON-AES)
2 2	151.101.130.49 151.101.130.49	54113 (FASTLY) (FASTLY)
2 2	68.67.160.186 68.67.160.186	29990 (ASN-APPNEX) (ASN-APPNEX)
2 3	52.203.90.63 52.203.90.63	14618 (AMAZON-AES) (AMAZON-AES)
2 2	104.18.25.173 104.18.25.173	13335 (CLOUDFLAR...) (CLOUDFLARENET)
1	108.139.47.115 108.139.47.115	16509 (AMAZON-02) (AMAZON-02)
1	44.210.227.34 44.210.227.34	14618 (AMAZON-AES) (AMAZON-AES)
1 1	2606:4700:440... 2606:4700:4400::ac40:97ee	13335 (CLOUDFLAR...) (CLOUDFLARENET)
1	75.2.13.80 75.2.13.80	16509 (AMAZON-02) (AMAZON-02)
82	43

9 216.219.95.231 (United States)

ASN19318 (IS-AS-1, US)
PTR: vps.viewliveevents.in

jahnaviwithsaathwiksamala.appvideo.fcliveevents.in	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

14 2600:9000:2209:c000:1f:8466:d380:21 (United States)

ASN16509 (AMAZON-02, US)

d39c1tueofpvm6.cloudfront.net	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 2607:f8b0:4002:c0f::61 (Atlanta, United States)

ASN15169 (GOOGLE, US)

www.googletagmanager.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 2606:4700:10::6814:4373 (United States)

ASN13335 (CLOUDFLARENET, US)

s10.histats.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 5.75.143.77 (Schöneiche, Germany)

ASN24940 (HETZNER-AS, DE)
PTR: static.77.143.75.5.clients.your-server.de

voddvrcdn.viewliveevents.in	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 149.56.240.127 (Montreal, Canada)

ASN16276 (OVH, FR)
PTR: ns534295.ip-149-56-240.net

s4.histats.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 2001:4860:4802:32::178 (United States)

ASN15169 (GOOGLE, US)

www.google-analytics.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 2001:4860:4802:32::181 (United States)

ASN15169 (GOOGLE, US)

analytics.google.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 2607:f8b0:4002:c1b::9d (Atlanta, United States)

ASN15169 (GOOGLE, US)

stats.g.doubleclick.net	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

3 2606:4700:21::8d65:780b (United States)

ASN13335 (CLOUDFLARENET, US)

e.dtscout.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools
t.dtscout.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 64.233.185.99 (United States)

ASN15169 (GOOGLE, US)
PTR: yb-in-f99.1e100.net

www.google.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 18.238.55.22 (United States)

ASN16509 (AMAZON-02, US)
PTR: server-18-238-55-22.jfk52.r.cloudfront.net

get.s-onetag.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 3.19.195.77 (Columbus, United States)

ASN16509 (AMAZON-02, US)
PTR: ec2-3-19-195-77.us-east-2.compute.amazonaws.com

pd.sharethis.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 172.64.153.173 (San Francisco, United States)

ASN13335 (CLOUDFLARENET, US)

cdn.tynt.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 18.173.132.31 (United States)

ASN16509 (AMAZON-02, US)
PTR: server-18-173-132-31.jfk52.r.cloudfront.net

onetag-geo.s-onetag.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 67.202.105.32 (United States)

ASN32748 (STEADFAST, US)
PTR: ip32.67-202-105.static.steadfastdns.net

ic.tynt.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 23.198.214.73 (Piscataway, United States)

ASN20940 (AKAMAI-ASN1, NL)
PTR: a23-198-214-73.deploy.static.akamaitechnologies.com

t.sharethis.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 67.202.105.31 (United States)

ASN32748 (STEADFAST, US)
PTR: ip31.67-202-105.static.steadfastdns.net

de.tynt.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 23.198.214.81 (Piscataway, United States)

ASN20940 (AKAMAI-ASN1, NL)
PTR: a23-198-214-81.deploy.static.akamaitechnologies.com

t.sharethis.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 108.139.29.87 (United States)

ASN16509 (AMAZON-02, US)
PTR: server-108-139-29-87.jfk50.r.cloudfront.net

data-beacons.s-onetag.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 104.18.35.167 (None, )

ASN13335 (CLOUDFLARENET, US)

cdn-tc.33across.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 67.202.105.23 (United States) 1 redirects

ASN32748 (STEADFAST, US)
PTR: ip23.67-202-105.static.steadfastdns.net

lex.33across.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

4 35.244.154.8 (Kansas City, United States) 3 redirects

ASN15169 (GOOGLE, US)
PTR: 8.154.244.35.bc.googleusercontent.com

rc.rlcdn.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools
idsync.rlcdn.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 34.98.64.218 (Kansas City, United States) 2 redirects

ASN396982 (GOOGLE-CLOUD-PLATFORM, US)
PTR: 218.64.98.34.bc.googleusercontent.com

us-u.openx.net	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 34.86.110.8 (Washington, United States)

ASN396982 (GOOGLE-CLOUD-PLATFORM, US)
PTR: 8.110.86.34.bc.googleusercontent.com

i.simpli.fi	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 107.178.254.65 (Kansas City, United States)

ASN396982 (GOOGLE-CLOUD-PLATFORM, US)
PTR: 65.254.178.107.bc.googleusercontent.com

pippio.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 108.138.128.34 (United States)

ASN16509 (AMAZON-02, US)
PTR: server-108-138-128-34.jfk50.r.cloudfront.net

tags.crwdcntrl.net	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 2606:4700:20::681a:d3c (United States)

ASN13335 (CLOUDFLARENET, US)

t.dtscdn.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 141.94.171.214 (France) 2 redirects

ASN16276 (OVH, FR)
PTR: pikafka-eu-8.cloudy.ovh

pixel.onaudience.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 23.37.233.35 (Edison, United States) 1 redirects

ASN16625 (AKAMAI-AS, US)
PTR: a23-37-233-35.deploy.static.akamaitechnologies.com

tags.bluekai.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

3 173.194.219.156 (United States) 3 redirects

ASN15169 (GOOGLE, US)
PTR: ya-in-f156.1e100.net

cm.g.doubleclick.net	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

3 52.3.41.35 (Ashburn, United States) 2 redirects

ASN14618 (AMAZON-AES, US)
PTR: ec2-52-3-41-35.compute-1.amazonaws.com

ap.lijit.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 44.209.254.124 (Ashburn, United States)

ASN14618 (AMAZON-AES, US)
PTR: ec2-44-209-254-124.compute-1.amazonaws.com

track2.securedvisit.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 13.226.34.99 (United States)

ASN16509 (AMAZON-02, US)
PTR: server-13-226-34-99.ewr53.r.cloudfront.net

api.intentiq.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

3 3.224.87.131 (Ashburn, United States) 3 redirects

ASN14618 (AMAZON-AES, US)
PTR: ec2-3-224-87-131.compute-1.amazonaws.com

i.liadm.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 108.138.106.51 (United States) 2 redirects

ASN16509 (AMAZON-02, US)
PTR: server-108-138-106-51.jfk50.r.cloudfront.net

live.rezync.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 199.38.167.130 (United States) 1 redirects

ASN54312 (ROCKETFUEL, US)

p.rfihub.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 2620:1ec:21::14 (United States) 1 redirects

ASN8068 (MICROSOFT-CORP-MSN-AS-BLOCK, US)

px.ads.linkedin.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 35.194.66.159 (Washington, United States) 1 redirects

ASN396982 (GOOGLE-CLOUD-PLATFORM, US)
PTR: 159.66.194.35.bc.googleusercontent.com

um.simpli.fi	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

3 3.235.217.129 (Ashburn, United States)

ASN14618 (AMAZON-AES, US)
PTR: ec2-3-235-217-129.compute-1.amazonaws.com

ce.lijit.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 18.238.55.108 (United States)

ASN16509 (AMAZON-02, US)
PTR: server-18-238-55-108.jfk52.r.cloudfront.net

get.s-onetag.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 54.234.166.1 (Ashburn, United States) 1 redirects

ASN14618 (AMAZON-AES, US)
PTR: ec2-54-234-166-1.compute-1.amazonaws.com

bcp.crwdcntrl.net	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

6 50.16.174.192 (Ashburn, United States)

ASN14618 (AMAZON-AES, US)
PTR: ec2-50-16-174-192.compute-1.amazonaws.com

ps.eyeota.net	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 172.67.163.146 (United States)

ASN13335 (CLOUDFLARENET, US)

a.dtssrv.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 108.138.128.28 (United States)

ASN16509 (AMAZON-02, US)
PTR: server-108-138-128-28.jfk50.r.cloudfront.net

tags.crwdcntrl.net	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 15.197.193.217 (Seattle, United States) 1 redirects

ASN16509 (AMAZON-02, US)
PTR: a12b7a488abeaa9e4.awsglobalaccelerator.com

match.adsrvr.org	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 34.200.65.202 (Ashburn, United States) 2 redirects

ASN14618 (AMAZON-AES, US)
PTR: ec2-34-200-65-202.compute-1.amazonaws.com

cms.analytics.yahoo.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools
ups.analytics.yahoo.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 151.101.130.49 (United States) 2 redirects

ASN54113 (FASTLY, US)

sync-tm.everesttech.net	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 68.67.160.186 (New York, United States) 2 redirects

ASN29990 (ASN-APPNEX, US)
PTR: 675.bm-nginx-loadbalancer.mgmt.nym2.adnexus.net

ib.adnxs.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

3 52.203.90.63 (Ashburn, United States) 2 redirects

ASN14618 (AMAZON-AES, US)
PTR: ec2-52-203-90-63.compute-1.amazonaws.com

thrtle.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 104.18.25.173 (None, ) 2 redirects

ASN13335 (CLOUDFLARENET, US)

a.tribalfusion.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools
s.tribalfusion.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 108.139.47.115 (United States)

ASN16509 (AMAZON-02, US)
PTR: server-108-139-47-115.jfk50.r.cloudfront.net

cdn.lijit.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 44.210.227.34 (Ashburn, United States)

ASN14618 (AMAZON-AES, US)
PTR: ec2-44-210-227-34.compute-1.amazonaws.com

ce.lijit.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 2606:4700:4400::ac40:97ee (United States) 1 redirects

ASN13335 (CLOUDFLARENET, US)

idpix.media6degrees.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 75.2.13.80 (United States)

ASN16509 (AMAZON-02, US)
PTR: a0cb5afe0ce76779e.awsglobalaccelerator.com

connect-metrics-collector.s-onetag.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

	Apex Domain Subdomains	Transfer
14	cloudfront.net d39c1tueofpvm6.cloudfront.net	459 KB
9	fcliveevents.in jahnaviwithsaathwiksamala.appvideo.fcliveevents.in	439 KB
8	lijit.com 2 redirects ap.lijit.com — Cisco Umbrella Rank: 715 ce.lijit.com — Cisco Umbrella Rank: 887 cdn.lijit.com — Cisco Umbrella Rank: 4656	24 KB
6	eyeota.net ps.eyeota.net — Cisco Umbrella Rank: 1182	3 KB
6	s-onetag.com get.s-onetag.com — Cisco Umbrella Rank: 5223 onetag-geo.s-onetag.com — Cisco Umbrella Rank: 7304 data-beacons.s-onetag.com — Cisco Umbrella Rank: 16456 connect-metrics-collector.s-onetag.com — Cisco Umbrella Rank: 5311	11 KB
5	crwdcntrl.net 1 redirects tags.crwdcntrl.net — Cisco Umbrella Rank: 1131 bcp.crwdcntrl.net — Cisco Umbrella Rank: 953	21 KB
5	doubleclick.net 3 redirects stats.g.doubleclick.net — Cisco Umbrella Rank: 91 cm.g.doubleclick.net — Cisco Umbrella Rank: 260	1 KB
4	rlcdn.com 3 redirects rc.rlcdn.com — Cisco Umbrella Rank: 4735 idsync.rlcdn.com — Cisco Umbrella Rank: 467	1 KB
4	sharethis.com pd.sharethis.com — Cisco Umbrella Rank: 14198 t.sharethis.com — Cisco Umbrella Rank: 6265	5 KB
3	thrtle.com 2 redirects thrtle.com — Cisco Umbrella Rank: 1354	2 KB
3	liadm.com 3 redirects i.liadm.com — Cisco Umbrella Rank: 576	2 KB
3	simpli.fi 1 redirects i.simpli.fi — Cisco Umbrella Rank: 4177 um.simpli.fi — Cisco Umbrella Rank: 835	1 KB
3	33across.com 1 redirects cdn-tc.33across.com — Cisco Umbrella Rank: 39342 lex.33across.com — Cisco Umbrella Rank: 4334	776 B
3	tynt.com cdn.tynt.com — Cisco Umbrella Rank: 15666 ic.tynt.com — Cisco Umbrella Rank: 13231 de.tynt.com — Cisco Umbrella Rank: 1524	9 KB
3	dtscout.com e.dtscout.com — Cisco Umbrella Rank: 17856 t.dtscout.com — Cisco Umbrella Rank: 15373	4 KB
2	tribalfusion.com 2 redirects a.tribalfusion.com — Cisco Umbrella Rank: 897 s.tribalfusion.com — Cisco Umbrella Rank: 2558	1 KB
2	adnxs.com 2 redirects ib.adnxs.com — Cisco Umbrella Rank: 255	2 KB
2	everesttech.net 2 redirects sync-tm.everesttech.net — Cisco Umbrella Rank: 732	660 B
2	yahoo.com 2 redirects cms.analytics.yahoo.com — Cisco Umbrella Rank: 1479 ups.analytics.yahoo.com — Cisco Umbrella Rank: 417	570 B
2	linkedin.com 1 redirects px.ads.linkedin.com — Cisco Umbrella Rank: 327	857 B
2	rezync.com 2 redirects live.rezync.com — Cisco Umbrella Rank: 1391	2 KB
2	bluekai.com 1 redirects tags.bluekai.com — Cisco Umbrella Rank: 751	741 B
2	onaudience.com 2 redirects pixel.onaudience.com — Cisco Umbrella Rank: 3165	726 B
2	pippio.com pippio.com — Cisco Umbrella Rank: 801	739 B
2	openx.net 2 redirects us-u.openx.net — Cisco Umbrella Rank: 535	665 B
2	google.com analytics.google.com — Cisco Umbrella Rank: 148 www.google.com — Cisco Umbrella Rank: 2	341 B
2	google-analytics.com www.google-analytics.com — Cisco Umbrella Rank: 34	21 KB
2	viewliveevents.in voddvrcdn.viewliveevents.in	710 B
2	histats.com s10.histats.com — Cisco Umbrella Rank: 15493 s4.histats.com — Cisco Umbrella Rank: 15484	5 KB
2	googletagmanager.com www.googletagmanager.com — Cisco Umbrella Rank: 42	158 KB
1	media6degrees.com 1 redirects idpix.media6degrees.com — Cisco Umbrella Rank: 2057	572 B
1	adsrvr.org 1 redirects match.adsrvr.org — Cisco Umbrella Rank: 350	366 B
1	dtssrv.com a.dtssrv.com — Cisco Umbrella Rank: 27216	440 B
1	rfihub.com 1 redirects p.rfihub.com — Cisco Umbrella Rank: 792	1 KB
1	intentiq.com api.intentiq.com — Cisco Umbrella Rank: 1672
1	securedvisit.com track2.securedvisit.com — Cisco Umbrella Rank: 4815	178 B
1	dtscdn.com t.dtscdn.com — Cisco Umbrella Rank: 16608	601 B
82	37

	Domain	Requested by
14	d39c1tueofpvm6.cloudfront.net	jahnaviwithsaathwiksamala.appvideo.fcliveevents.in d39c1tueofpvm6.cloudfront.net
9	jahnaviwithsaathwiksamala.appvideo.fcliveevents.in	jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
6	ps.eyeota.net	data-beacons.s-onetag.com
4	ce.lijit.com	jahnaviwithsaathwiksamala.appvideo.fcliveevents.in ap.lijit.com
3	thrtle.com	2 redirects
3	i.liadm.com	3 redirects
3	ap.lijit.com	2 redirects jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
3	cm.g.doubleclick.net	3 redirects
3	tags.crwdcntrl.net	e.dtscout.com tags.crwdcntrl.net
3	rc.rlcdn.com	3 redirects
2	ib.adnxs.com	2 redirects
2	sync-tm.everesttech.net	2 redirects
2	bcp.crwdcntrl.net	1 redirects tags.crwdcntrl.net
2	px.ads.linkedin.com	1 redirects jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
2	live.rezync.com	2 redirects
2	tags.bluekai.com	1 redirects jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
2	pixel.onaudience.com	2 redirects
2	pippio.com	jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
2	i.simpli.fi	jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
2	us-u.openx.net	2 redirects
2	lex.33across.com	1 redirects jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
2	t.sharethis.com	pd.sharethis.com t.sharethis.com
2	onetag-geo.s-onetag.com	get.s-onetag.com
2	pd.sharethis.com	e.dtscout.com jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
2	get.s-onetag.com	e.dtscout.com get.s-onetag.com
2	t.dtscout.com	e.dtscout.com
2	stats.g.doubleclick.net	www.googletagmanager.com www.google-analytics.com
2	www.google-analytics.com	www.googletagmanager.com www.google-analytics.com
2	voddvrcdn.viewliveevents.in	d39c1tueofpvm6.cloudfront.net
2	www.googletagmanager.com	jahnaviwithsaathwiksamala.appvideo.fcliveevents.in www.googletagmanager.com
1	connect-metrics-collector.s-onetag.com	get.s-onetag.com
1	idpix.media6degrees.com	1 redirects
1	cdn.lijit.com
1	s.tribalfusion.com	1 redirects
1	a.tribalfusion.com	1 redirects
1	ups.analytics.yahoo.com	1 redirects
1	cms.analytics.yahoo.com	1 redirects
1	match.adsrvr.org	1 redirects
1	a.dtssrv.com	e.dtscout.com
1	um.simpli.fi	1 redirects
1	p.rfihub.com	1 redirects
1	api.intentiq.com	data-beacons.s-onetag.com
1	track2.securedvisit.com	data-beacons.s-onetag.com
1	t.dtscdn.com	e.dtscout.com
1	idsync.rlcdn.com	jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
1	cdn-tc.33across.com	de.tynt.com
1	data-beacons.s-onetag.com	get.s-onetag.com
1	de.tynt.com	cdn.tynt.com
1	ic.tynt.com	jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
1	cdn.tynt.com	e.dtscout.com
1	www.google.com	jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
1	e.dtscout.com	s4.histats.com
1	analytics.google.com	www.googletagmanager.com
1	s4.histats.com	s10.histats.com
1	s10.histats.com	jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
82	55

This site contains links to these domains. Also see Links.

Domain
www.viewliveevents.com

Subject Issuer	Validity	Valid
jahnaviwithsaathwiksamala.appvideo.fcliveevents.in R3	`2024-03-29` - `2024-06-27`	3 months	crt.sh
*.cloudfront.net Amazon RSA 2048 M01	`2023-10-10` - `2024-09-19`	a year	crt.sh
*.google-analytics.com GTS CA 1C3	`2024-03-04` - `2024-05-27`	3 months	crt.sh
sni.cloudflaressl.com Cloudflare Inc ECC CA-3	`2023-05-13` - `2024-05-11`	a year	crt.sh
*.viewliveevents.in AlphaSSL CA - SHA256 - G4	`2023-03-24` - `2024-04-24`	a year	crt.sh
histats.com R3	`2024-02-16` - `2024-05-16`	3 months	crt.sh
*.google.com GTS CA 1C3	`2024-03-04` - `2024-05-27`	3 months	crt.sh
*.g.doubleclick.net GTS CA 1C3	`2024-03-04` - `2024-05-27`	3 months	crt.sh
dtscout.com GTS CA 1P5	`2024-03-17` - `2024-06-15`	3 months	crt.sh
*.s-onetag.com Amazon RSA 2048 M03	`2023-11-04` - `2024-12-01`	a year	crt.sh
sharethis.com Amazon RSA 2048 M02	`2023-05-22` - `2024-06-19`	a year	crt.sh
*.tynt.com Sectigo RSA Domain Validation Secure Server CA	`2023-09-05` - `2024-09-30`	a year	crt.sh
cert1-prod.aut.a24365.net R3	`2024-03-29` - `2024-06-27`	3 months	crt.sh
*.33across.com Sectigo RSA Domain Validation Secure Server CA	`2023-09-06` - `2024-09-30`	a year	crt.sh
*.simpli.fi DigiCert Global G2 TLS RSA SHA256 2020 CA1	`2023-11-07` - `2024-12-07`	a year	crt.sh
*.crwdcntrl.net Amazon RSA 2048 M01	`2023-10-08` - `2024-11-05`	a year	crt.sh
dtscdn.com GTS CA 1P5	`2024-03-13` - `2024-06-11`	3 months	crt.sh
securedvisit.com Amazon RSA 2048 M03	`2023-08-16` - `2024-09-13`	a year	crt.sh
*.intentiq.com Amazon RSA 2048 M03	`2024-03-26` - `2025-04-24`	a year	crt.sh
eyeota.net GoGetSSL RSA DV CA	`2023-03-08` - `2024-04-07`	a year	crt.sh
dtssrv.com GTS CA 1P5	`2024-03-22` - `2024-06-20`	3 months	crt.sh
*.lijit.com Amazon RSA 2048 M03	`2024-02-11` - `2025-03-12`	a year	crt.sh

This page contains 8 frames:

Primary Page: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Frame ID: AFBC0ED9B311FEB38936EAD1662D2724
Requests: 80 HTTP requests in this frame

Frame: https://t.dtscout.com/idg/?su=51A01711761383C3AD6250C483A92E62
Frame ID: BAB4208F6F96A614D69C7AE31CFD501F
Requests: 1 HTTP requests in this frame

Frame: https://t.sharethis.com/a/t_.htm?ver=1.1325.23384&cid=c010&cls=C
Frame ID: FE7C5FA3E2B5B030BFA201D3D11A2D79
Requests: 1 HTTP requests in this frame

Frame: https://cdn-tc.33across.com/lotame-sync.html
Frame ID: 889012647769F78BA4F9E0960D18A930
Requests: 1 HTTP requests in this frame

Frame: https://api.intentiq.com/profiles_engine/ProfilesEngineServlet?at=15&eid=19&aw=468&ah=60&pagePos=1&vip=true&secure=1&sub_eid=15052&maxed=1&rnd=51051
Frame ID: 199136E11F7B7E787056036E226D4EB4
Requests: 1 HTTP requests in this frame

Frame: https://get.s-onetag.com/underground-sync-portal/Portal.html
Frame ID: D18ACE9835FFF0B9963807A15CB9C45B
Requests: 1 HTTP requests in this frame

Frame: https://tags.crwdcntrl.net/lt/shared/2/lt.iframe.html?c=3825
Frame ID: FEF035EFE7BE69E5A8B9FEC5CAFD35D6
Requests: 1 HTTP requests in this frame

Frame: https://ce.lijit.com/beacon?informer=&gdpr_consent=&us_privacy=&gpp=&gpp_sid=
Frame ID: 51EC53AA94D4507D97E3C5830B3FBD1F
Requests: 1 HTTP requests in this frame

Screenshot
Live screenshot

Full Image

Page Title

LIVE: Jahnavi with Saathwik Samala

Detected technologies

Bootstrap (Web Frameworks) Expand

Overall confidence: 100%
Detected patterns

<link[^>]* href=[^>]*?bootstrap(?:[^>]*?([0-9a-fA-F]{7,40}|[\d]+(?:.[\d]+(?:.[\d]+)?)?)|)[^>]*?(?:\.min)?\.css
bootstrap(?:[^>]*?([0-9a-fA-F]{7,40}|[\d]+(?:.[\d]+(?:.[\d]+)?)?)|)[^>]*?(?:\.min)?\.js

Google Analytics (Analytics) Expand

Overall confidence: 100%
Detected patterns

google-analytics\.com/(?:ga|urchin|analytics)\.js

Google Tag Manager (Tag Managers) Expand

Overall confidence: 100%
Detected patterns

googletagmanager\.com/gtag/js

Lightbox (JavaScript Libraries) Expand

Modernizr (JavaScript Libraries) Expand

Overall confidence: 100%
Detected patterns

([\d.]+)?/modernizr(?:\.([\d.]+))?.*\.js

jQuery (JavaScript Libraries) Expand

Overall confidence: 100%
Detected patterns

jquery.*\.js(?:\?ver(?:sion)?=([\d.]+))?

Page Statistics

82
Requests

78 %
HTTPS

18 %
IPv6

37
Domains

55
Subdomains

43
IPs

5
Countries

1168 kB
Transfer

2543 kB
Size

203
Cookies

1 Outgoing links

These are links going to different origins than the main page.

URL: http://www.viewliveevents.com/
Title: .

Search URL Search Domain Scan URL

Redirected requests

There were HTTP redirect chains for the following requests:

Request Chain 54

https://lex.33across.com/ps/v1/pubtoken/?pid=128&us_privacy=&rnd=1711761384492.1&ru=https%3A%2F%2Flive.rezync.com%2Fsync%3Fc%3D4656c20ee35215f78e9273796625d90b%26p%3Dcab5a4722e64fa65aba8e60b6da5d556%26pcat%3D%26pdev%3D%26pctry%3DUS%26referrer%3Dhttps%253A%252F%252Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%252F%26us_privacy%3D%24%7BUS_PRIVACY%7D%26cache_buster%3D%24%7BRANDOM%7D%26custom1%3D%24%7BPUBTOK%7D HTTP 302
https://lex.33across.com/ps/v1/pubtoken/?pid=128&us_privacy=&rnd=1711761384492.1&ru=https%3A%2F%2Flive.rezync.com%2Fsync%3Fc%3D4656c20ee35215f78e9273796625d90b%26p%3Dcab5a4722e64fa65aba8e60b6da5d556%26pcat%3D%26pdev%3D%26pctry%3DUS%26referrer%3Dhttps%253A%252F%252Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%252F%26us_privacy%3D%24%7BUS_PRIVACY%7D%26cache_buster%3D%24%7BRANDOM%7D%26custom1%3D%24%7BPUBTOK%7D&b=1

Request Chain 55

https://rc.rlcdn.com/361726.gif?n=1&33random=1711761384492.2 HTTP 307
https://rc.rlcdn.com/1000.gif?memo=CP6JFhoNCOjPnbAGEgUI6AcQAEIASgA HTTP 307
https://us-u.openx.net/w/1.0/cm?id=e508c905-ddce-4732-92a4-0b0f5b72a28f&r=https%3A%2F%2Fidsync.rlcdn.com%2F396846.gif%3Fserved_by%3Devergreen%26partner_uid%3D HTTP 302
https://us-u.openx.net/w/1.0/cm?cc=1&id=e508c905-ddce-4732-92a4-0b0f5b72a28f&r=https%3A%2F%2Fidsync.rlcdn.com%2F396846.gif%3Fserved_by%3Devergreen%26partner_uid%3D HTTP 302
https://idsync.rlcdn.com/396846.gif?served_by=evergreen&partner_uid=cfaad51a-55c2-4f55-94d2-14f88558095f

Request Chain 57

https://rc.rlcdn.com/361726.gif?n=1&33random=1711761384492.5 HTTP 307
https://pippio.com/api/sync?pid=5324&_=2

Request Chain 61

https://pixel.onaudience.com/?partner=137085098&mapped=51A01711761383C3AD6250C483A92E62 HTTP 302
https://pixel.onaudience.com/?partner=109&icm&cver&gdpr=0&smartmap=1&redirect=tags.bluekai.com%2Fsite%2F33141%3F%26id%3D%25m HTTP 302
https://tags.bluekai.com/site/33141?&id=9898b2ce7b9d420c HTTP 302
https://cm.g.doubleclick.net/pixel?google_nid=bluekai&google_cm&google_sc&google_hm=YTMvNGVId005OU8xcTk1Wg%3D%3D HTTP 302
https://cm.g.doubleclick.net/pixel?google_nid=bluekai&google_cm=&google_sc=&google_hm=YTMvNGVId005OU8xcTk1Wg%3D%3D&google_tc= HTTP 302
https://tags.bluekai.com/site/2981?id=&google_gid=CAESEJ4NHEc76tDvdUY8H9Nhfbs&google_cver=1

Request Chain 62

https://ap.lijit.com/readerinfo/v2 HTTP 307
https://ap.lijit.com/readerinfo/v2?sovrn_retry=true

Request Chain 65

https://i.liadm.com/s/76929?bidder_id=204553&bidder_uuid=IZ6MASZHEJmM2GwjRW6x-cEw&rnd=16377 HTTP 303
https://i.liadm.com/s/76929?bidder_id=204553&bidder_uuid=IZ6MASZHEJmM2GwjRW6x-cEw&rnd=16377&_li_chk=true&previous_uuid=5ef81211c4b84025b6988d908aa1734d HTTP 303
https://live.rezync.com/sync?c=0aa2530f29e4f4a05b5d5d9bb35d60c2&p=93c1662463a616a7155169889dd99651&pid=5ef81211-c4b8-4025-b698-8d908aa1734d HTTP 302
https://p.rfihub.com/cm?pub=39342&in=1&userid=87e27168-f1d7-4beb-a884-8db65a6ff223%3A1711761387.9673643&forward=https%3A//i.liadm.com/s/56409%3Fbidder_id%3D200442%26bidder_uuid%3D87e27168-f1d7-4beb-a884-8db65a6ff223%253A1711761387.9673643%26pid%3D500040%26it%3D1%26iv%3D87e27168-f1d7-4beb-a884-8db65a6ff223%253A1711761387.9673643%26_%3D1711761387.969343&cb=1711761387.9693847 HTTP 302
https://live.rezync.com/pixel?c=bd8618c307ae9885a12561b7191e2cea&cid=970033174938740873&referrer={encSite}&forward=https%3A%2F%2Fi.liadm.com%2Fs%2F56409%3Fbidder_id%3D200442%26bidder_uuid%3D87e27168-f1d7-4beb-a884-8db65a6ff223%253A1711761387.9673643%26pid%3D500040%26it%3D1%26iv%3D87e27168-f1d7-4beb-a884-8db65a6ff223%253A1711761387.9673643%26_%3D1711761387.969343 HTTP 302
https://i.liadm.com/s/56409?bidder_id=200442&bidder_uuid=87e27168-f1d7-4beb-a884-8db65a6ff223%3A1711761387.9673643&pid=500040&it=1&iv=87e27168-f1d7-4beb-a884-8db65a6ff223%3A1711761387.9673643&_=1711761387.969343 HTTP 303
https://pippio.com/api/sync?it=1&pid=500040&_=1711761387.969343&iv=87e27168-f1d7-4beb-a884-8db65a6ff223:1711761387.9673643

Request Chain 66

https://px.ads.linkedin.com/db_sync?pid=15697&puuid=IZ6MASZHEJmM2GwjRW6x-cEw&rand=88759&pu= HTTP 302
https://px.ads.linkedin.com/db_sync?pid=15697&puuid=IZ6MASZHEJmM2GwjRW6x-cEw&rand=88759&pu=&expected_cookie=545913c9-559e-43b6-a1b0-8c321336a7a5

Request Chain 67

https://um.simpli.fi/lj_match?r=58644 HTTP 302
https://ce.lijit.com/merge?pid=2&3pid=49DBE3392DC240ABA420ABA7428B6F9E

Request Chain 71

https://bcp.crwdcntrl.net/5/c=5436/tp=SVRN/tpid=IZ6MASZHEJmM2GwjRW6x-cEw/pv=y?https://ce.lijit.com/merge?pid=5001&3pid=${profile_id} HTTP 302
https://ce.lijit.com/merge?pid=5001&3pid=e892471a0e85b5173c586ecb825ddae7

Request Chain 76

https://match.adsrvr.org/track/cmf/generic?ttd_pid=eyeota&ttd_tpi=1&gdpr=0&gdpr_consent= HTTP 302
https://ps.eyeota.net/match?uid=cba85754-2b38-48f3-8e98-6a1492b11d52&bid=1e2n4ou

Request Chain 77

https://cm.g.doubleclick.net/pixel?google_nid=eye&google_cm&google_sc&google_hm=MnlpazRaSGl3clU5TGxSUGNXamFJVlJuVUEtcmxUTHVjNTFveE92aGV4SzA&gdpr=0&gdpr_consent=&uid=1&bid=gdo9o51&newuser=1&referrer_pid=51md42u HTTP 302
https://ps.eyeota.net/match?gdpr=0&gdpr_consent=&uid=1&bid=gdo9o51&newuser=1&referrer_pid=51md42u&google_gid=CAESEDNqN2u03NnXkd5tooDyot8&google_cver=1

Request Chain 78

https://cms.analytics.yahoo.com/cms?partner_id=Eyeot HTTP 302
https://ups.analytics.yahoo.com/ups/58773/cms?partner_id=Eyeot HTTP 302
https://ps.eyeota.net/match?bid=bhc9gd0&yahoo_ver=2&yahoo_id=y-DuIKkhpE2pWHOtT0q86vMzh7Bs3abFACTjs-~A

Request Chain 79

https://sync-tm.everesttech.net/upi/pid/lons7jax?redir=https%3A%2F%2Fps.eyeota.net%2Fmatch%3Fuid%3D%24%7BTM_USER_ID%7D%26bid%3D0rijhbu%26referrer_pid%3D51md42u HTTP 302
https://sync-tm.everesttech.net/ct/upi/pid/lons7jax?redir=https%3A%2F%2Fps.eyeota.net%2Fmatch%3Fuid%3D%24%7BTM_USER_ID%7D%26bid%3D0rijhbu%26referrer_pid%3D51md42u&_test=Zgdn7QACPAzVcgBi HTTP 302
https://ps.eyeota.net/match?uid=Zgdn7QACPAzVcgBi&bid=0rijhbu&referrer_pid=51md42u&_test=Zgdn7QACPAzVcgBi

Request Chain 80

https://ib.adnxs.com/getuid?https%3A%2F%2Fps.eyeota.net%2Fmatch%3Fuid%3D%24UID%26bid%3D2cr76e1%26referrer_pid%3D51md42u HTTP 307
https://ib.adnxs.com/bounce?%2Fgetuid%3Fhttps%253A%252F%252Fps.eyeota.net%252Fmatch%253Fuid%253D%2524UID%2526bid%253D2cr76e1%2526referrer_pid%253D51md42u HTTP 302
https://ps.eyeota.net/match?uid=5134189823149296003&bid=2cr76e1&referrer_pid=51md42u

Request Chain 81

https://thrtle.com/sync?vxii_pid=7002&vxii_pdid=IZ6MASZHEJmM2GwjRW6x-cEw HTTP 302
https://thrtle.com/sync?_reach=1&vxii_pdid=IZ6MASZHEJmM2GwjRW6x-cEw&vxii_pid=12&vxii_pid1=7002&vxii_rcid=33d58b9a-4412-499c-94eb-8ee8453ba781&vxii_rmax=1 HTTP 302
https://a.tribalfusion.com/i.match?p=b31&redirect=https%3A%2F%2Fthrtle.com%2Fsync%3Fvxii_pid%3D5042%26vxii_pdid%3D%24TF_USER_ID_ENC%24%26vxii_ts%3D1%26_t%3D1711761390%26_reach%3D1&u=33d58b9a-4412-499c-94eb-8ee8453ba781 HTTP 302
https://s.tribalfusion.com/z/i.match?p=b31&redirect=https%3A%2F%2Fthrtle.com%2Fsync%3Fvxii_pid%3D5042%26vxii_pdid%3D%24TF_USER_ID_ENC%24%26vxii_ts%3D1%26_t%3D1711761390%26_reach%3D1&u=33d58b9a-4412-499c-94eb-8ee8453ba781 HTTP 302
https://thrtle.com/sync?vxii_pid=5042&vxii_pdid=18072662076936486681&vxii_ts=1&_t=1711761390&_reach=1

Request Chain 82

https://ap.lijit.com/www/sovrn_beacon_standalone/sovrn_standalone_beacon.js HTTP 302
https://cdn.lijit.com/www/sovrn_beacon_standalone/sovrn_standalone_beacon.js

Request Chain 84

https://idpix.media6degrees.com/orbserv/hbpix?pixId=853949&pcv=129&ptid=39&tpuv=01&tpu=IZ6MASZHEJmM2GwjRW6x-cEw HTTP 302
https://ce.lijit.com/merge?pid=5&3pid=0g9uhs8b1v4u5&us_privacy=$(US_PRIVACY)

82 HTTP transactions
5 data transactions

Method
Protocol Status Resource
Path Size
x-fer Time
Latency Type
MIME-Type IP
Location

GET
H2 200 Primary Request / Show response
jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ 15 KB
4 KB 516ms
116ms Document
text/html 216.219.95.231
IS-AS-1

General

Check archive.org

Show headers Download Go to

Full URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 216.219.95.231 , United States, ASN19318 (IS-AS-1, US),
Reverse DNS: vps.viewliveevents.in
Software: LiteSpeed /
Resource Hash: c013d9cd6c21679c29a8e165b78b36b8279af7eb8f254a0cafd465cd09ece262

Request headers

Upgrade-Insecure-Requests: 1
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
accept-language: en-US,en;q=0.9
sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-mobile: ?0
sec-ch-ua-platform: "Win32"

Response headers

alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"
content-encoding: gzip
content-length: 4187
content-type: text/html; charset=UTF-8
date: Sat, 30 Mar 2024 01:16:21 GMT
server: LiteSpeed
vary: Accept-Encoding

GET
H2 200 allstyles.css
d39c1tueofpvm6.cloudfront.net/dev/netliveassets/css/ 12 KB
3 KB 350ms
88ms Stylesheet
text/css 2600:9000:2209:c000:1f:8466:d380:21
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/css/allstyles.css
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2600:9000:2209:c000:1f:8466:d380:21 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS
Software: AmazonS3 /
Resource Hash: ab22cd01989ebab4166f91856fb9f07e9120a2ae7e2b025e460cad8ec956ae48

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

x-amz-version-id: _E50oGNa2gpTSsn4w09WLOLSIOLa0b66
content-encoding: gzip
via: 1.1 ae9634deb2e9d6f8d396fc6f1e0586fa.cloudfront.net (CloudFront)
date: Fri, 29 Mar 2024 11:44:51 GMT
last-modified: Sat, 06 Feb 2021 12:18:49 GMT
server: AmazonS3
x-amz-cf-pop: EWR53-P1
age: 48691
etag: W/"ff493e02aeb9c62e186317441c079086"
vary: Accept-Encoding
x-amz-meta-sha256: ab22cd01989ebab4166f91856fb9f07e9120a2ae7e2b025e460cad8ec956ae48
content-type: text/css
x-cache: Hit from cloudfront
x-amz-cf-id: xedJzLqTdgmV-471VEa8STGljFpDGCP-cp8IZSrGAQOb5HVz9DQASA==
x-amz-meta-s3b-last-modified: 20170709T160852Z

GET
H2 200 style.css
d39c1tueofpvm6.cloudfront.net/dev/netliveassets/designs/wedding-4/ 3 KB
1 KB 420ms
160ms Stylesheet
text/css 2600:9000:2209:c000:1f:8466:d380:21
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/designs/wedding-4/style.css
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2600:9000:2209:c000:1f:8466:d380:21 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS
Software: AmazonS3 /
Resource Hash: 4b6bcea07fb26c85c0ab9c4cbba54a5a10fa87338d8f4f401217090b7d256fd1

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

x-amz-version-id: WOUlka3Y72F5lFuyocrrV6s2v9ZpzFec
content-encoding: gzip
via: 1.1 ae9634deb2e9d6f8d396fc6f1e0586fa.cloudfront.net (CloudFront)
date: Sat, 30 Mar 2024 01:11:09 GMT
last-modified: Tue, 23 Feb 2021 05:30:20 GMT
server: AmazonS3
x-amz-cf-pop: EWR53-P1
age: 3563
etag: W/"b6a53b391902eaee136b8e4d93c55258"
vary: Accept-Encoding
x-amz-meta-sha256: 4b6bcea07fb26c85c0ab9c4cbba54a5a10fa87338d8f4f401217090b7d256fd1
content-type: text/css
x-cache: Hit from cloudfront
x-amz-cf-id: UtFY7111UWk02EF6yOQVNF8Zlx1QLBFz2thgC375IkuJf38z4NwSDg==
x-amz-meta-s3b-last-modified: 20210201T060443Z

GET
H2 200 bootstrap.min.css
d39c1tueofpvm6.cloudfront.net/dev/netliveassets/megacdn/ 118 KB
20 KB 338ms
78ms Stylesheet
text/css 2600:9000:2209:c000:1f:8466:d380:21
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/megacdn/bootstrap.min.css
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2600:9000:2209:c000:1f:8466:d380:21 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS
Software: AmazonS3 /
Resource Hash: f75e846cc83bd11432f4b1e21a45f31bc85283d11d372f7b19accd1bf6a2635c

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

x-amz-version-id: DjjVTukX28P5SlYQMR3qsEIgBTgHX8Jm
content-encoding: gzip
via: 1.1 ae9634deb2e9d6f8d396fc6f1e0586fa.cloudfront.net (CloudFront)
date: Fri, 29 Mar 2024 12:04:57 GMT
x-amz-cf-pop: EWR53-P1
age: 48691
x-amz-server-side-encryption: AES256
x-amz-meta-sha256: f75e846cc83bd11432f4b1e21a45f31bc85283d11d372f7b19accd1bf6a2635c
x-cache: Hit from cloudfront
last-modified: Sat, 03 Jun 2023 10:52:49 GMT
server: AmazonS3
etag: W/"ec3bb52a00e176a7181d454dffaea219"
vary: Accept-Encoding
content-type: text/css
x-amz-cf-id: J12QSalC6e-tZBUMkyXfxz_boLjuEyElaS42tPzFLmtZlqZ2JuqFTQ==
x-amz-meta-s3b-last-modified: 20230603T104828Z

GET
H2 200 jquery.min.js Show response
d39c1tueofpvm6.cloudfront.net/dev/netliveassets/megacdn/ 85 KB
30 KB 402ms
141ms Script
application/javascript 2600:9000:2209:c000:1f:8466:d380:21
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/megacdn/jquery.min.js
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2600:9000:2209:c000:1f:8466:d380:21 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS
Software: AmazonS3 /
Resource Hash: 87083882cc6015984eb0411a99d3981817f5dc5c90ba24f0940420c5548d82de

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 29 Mar 2024 11:33:04 GMT
x-amz-version-id: 9S6j.tn4hv36ymN3GwRVP_rZSCNQnxkN
content-encoding: gzip
via: 1.1 ae9634deb2e9d6f8d396fc6f1e0586fa.cloudfront.net (CloudFront)
x-amz-cf-pop: EWR53-P1
age: 49398
x-amz-server-side-encryption: AES256
x-amz-meta-sha256: 87083882cc6015984eb0411a99d3981817f5dc5c90ba24f0940420c5548d82de
x-cache: Hit from cloudfront
last-modified: Sat, 03 Jun 2023 10:18:31 GMT
server: AmazonS3
etag: W/"c9f5aeeca3ad37bf2aa006139b935f0a"
vary: Accept-Encoding
content-type: application/javascript
x-amz-cf-id: hL1BRN8Al1ihKoywR0ip4wONersOMT1LQObb5VOeElr0calmfJM7kQ==
x-amz-meta-s3b-last-modified: 20230603T101631Z

GET
H2 200 modernizr.custom.js Show response
d39c1tueofpvm6.cloudfront.net/dev/netliveassets/js/ 8 KB
4 KB 421ms
161ms Script
application/javascript 2600:9000:2209:c000:1f:8466:d380:21
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/js/modernizr.custom.js
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2600:9000:2209:c000:1f:8466:d380:21 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS
Software: AmazonS3 /
Resource Hash: a0c589946d84942306502e5ae80c7a349409836f7aee0e2faa5456e5607e0342

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 29 Mar 2024 11:33:04 GMT
x-amz-version-id: Hqprj5z.JpGNZBPqLKIY685a.bLSx6_W
content-encoding: gzip
last-modified: Sat, 06 Feb 2021 12:18:48 GMT
server: AmazonS3
via: 1.1 ae9634deb2e9d6f8d396fc6f1e0586fa.cloudfront.net (CloudFront)
x-amz-cf-pop: EWR53-P1
etag: W/"f216daa52e3ef3493eb9167ebe927de9"
age: 49398
vary: Accept-Encoding
x-amz-meta-sha256: a0c589946d84942306502e5ae80c7a349409836f7aee0e2faa5456e5607e0342
content-type: application/javascript
x-cache: Hit from cloudfront
x-amz-cf-id: w8Ii7RMZ0THbLSscIYV5W1BujP6UUkoR74R7haO4YzLndLE2o1mVdQ==
x-amz-meta-s3b-last-modified: 20170709T160900Z

GET
H2 200 bootstrap.min.js Show response
d39c1tueofpvm6.cloudfront.net/dev/netliveassets/megacdn/ 36 KB
10 KB 427ms
167ms Script
application/javascript 2600:9000:2209:c000:1f:8466:d380:21
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/megacdn/bootstrap.min.js
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2600:9000:2209:c000:1f:8466:d380:21 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS
Software: AmazonS3 /
Resource Hash: 53964478a7c634e8dad34ecc303dd8048d00dce4993906de1bacf67f663486ef

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

x-amz-version-id: pUWB8o0Sb8..liqELKf6eTIe6T57IPXj
content-encoding: gzip
via: 1.1 ae9634deb2e9d6f8d396fc6f1e0586fa.cloudfront.net (CloudFront)
date: Fri, 29 Mar 2024 12:05:02 GMT
x-amz-cf-pop: EWR53-P1
age: 48691
x-amz-server-side-encryption: AES256
x-amz-meta-sha256: 53964478a7c634e8dad34ecc303dd8048d00dce4993906de1bacf67f663486ef
x-cache: Hit from cloudfront
last-modified: Sat, 03 Jun 2023 11:26:08 GMT
server: AmazonS3
etag: W/"5869c96cc8f19086aee625d670d741f9"
vary: Accept-Encoding
content-type: application/javascript
x-amz-cf-id: 0FUt8Y7HetExfUuYX-3TLl9oQ8dN6dYOZFuCdaIupFMeOOeRYXQbJQ==
x-amz-meta-s3b-last-modified: 20230603T112058Z

GET
H2 200 updated.js Show response
jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ 850 B
506 B 110ms
98ms Script
application/x-javascript 216.219.95.231
IS-AS-1

General

Check archive.org

Show headers Download Go to

Full URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/updated.js
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 216.219.95.231 , United States, ASN19318 (IS-AS-1, US),
Reverse DNS: vps.viewliveevents.in
Software: LiteSpeed /
Resource Hash: 12bb4c039d2eb8a68fc15fc387f237426adbb33f565768fd69b781302fb4751a

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:16:21 GMT
content-encoding: br
last-modified: Sat, 09 Sep 2023 12:56:44 GMT
server: LiteSpeed
etag: "352-64fc6b8c-15040772;br"
vary: Accept-Encoding
content-type: application/x-javascript
cache-control: public, max-age=604800
accept-ranges: bytes
alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"
content-length: 352
expires: Sat, 06 Apr 2024 01:16:21 GMT

GET
H2 200 updated.css
jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ 3 KB
407 B 118ms
110ms Stylesheet
text/css 216.219.95.231
IS-AS-1

General

Check archive.org

Show headers Download Go to

Full URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/updated.css
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 216.219.95.231 , United States, ASN19318 (IS-AS-1, US),
Reverse DNS: vps.viewliveevents.in
Software: LiteSpeed /
Resource Hash: 81c6737ba56c1e094f3a71967b8c158fa54383b6a57e373e961967b264279c66

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:16:21 GMT
content-encoding: br
last-modified: Sat, 09 Sep 2023 12:56:44 GMT
server: LiteSpeed
etag: "b12-64fc6b8c-15040771;br"
vary: Accept-Encoding
content-type: text/css
cache-control: public, max-age=604800
accept-ranges: bytes
alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"
content-length: 335
expires: Sat, 06 Apr 2024 01:16:21 GMT

GET
H2 200 lightbox.css
jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/lightboxcss/ 24 KB
14 KB 223ms
215ms Stylesheet
text/css 216.219.95.231
IS-AS-1

General

Check archive.org

Show headers Download Go to

Full URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/lightboxcss/lightbox.css
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 216.219.95.231 , United States, ASN19318 (IS-AS-1, US),
Reverse DNS: vps.viewliveevents.in
Software: LiteSpeed /
Resource Hash: 48c0bf8e1b336176562a8daf8749f07554f8de821bce7e8c224a1c54d0bb65de

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:16:21 GMT
content-encoding: br
last-modified: Sat, 09 Sep 2023 12:56:44 GMT
server: LiteSpeed
etag: "5e30-64fc6b8c-1743cce0;br"
vary: Accept-Encoding
content-type: text/css
cache-control: public, max-age=604800
accept-ranges: bytes
alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"
content-length: 14666
expires: Sat, 06 Apr 2024 01:16:21 GMT

GET
H2 200 lightbox.js Show response
jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/lightboxjs/ 27 KB
5 KB 231ms
223ms Script
application/x-javascript 216.219.95.231
IS-AS-1

General

Check archive.org

Show headers Download Go to

Full URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/lightboxjs/lightbox.js
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 216.219.95.231 , United States, ASN19318 (IS-AS-1, US),
Reverse DNS: vps.viewliveevents.in
Software: LiteSpeed /
Resource Hash: bd2a2141b31892909c0d018d2cf9e1138522f4723f0b31273f0d4bd303fe8b8a

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:16:21 GMT
content-encoding: br
last-modified: Sat, 09 Sep 2023 12:56:44 GMT
server: LiteSpeed
etag: "6df9-64fc6b8c-17836515;br"
vary: Accept-Encoding
content-type: application/x-javascript
cache-control: public, max-age=604800
accept-ranges: bytes
alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"
content-length: 5433
expires: Sat, 06 Apr 2024 01:16:21 GMT

GET
H2 200 js Show response
www.googletagmanager.com/gtag/ 148 KB
57 KB 252ms
86ms Script
application/javascript 2607:f8b0:4002:c0f::61
GOOGLE

General

Check archive.org

Show headers Download Go to

Full URL

https://www.googletagmanager.com/gtag/js?id=UA-25105023-19

Requested by

Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/

Protocol

Security

TLS 1.3, , AES_128_GCM

Server

2607:f8b0:4002:c0f::61 Atlanta, United States, ASN15169 (GOOGLE, US),

Reverse DNS

Software

Google Tag Manager /

Resource Hash

ef44d61e110a20b1a231db1ba8696f543c21bcd0e4195d461fbdb399b74276f0

Security Headers

Name	Value
Strict-Transport-Security	max-age=31536000; includeSubDomains
X-Xss-Protection	0

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:16:21 GMT
content-encoding: br
strict-transport-security: max-age=31536000; includeSubDomains
server: Google Tag Manager
vary: Accept-Encoding
content-type: application/javascript; charset=UTF-8
access-control-allow-origin: *
cache-control: private, max-age=900
access-control-allow-credentials: true
cross-origin-resource-policy: cross-origin
access-control-allow-headers: Cache-Control
content-length: 57753
x-xss-protection: 0
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
expires: Sat, 30 Mar 2024 01:16:21 GMT

GET
H2 200 menu.png
jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/images/ 128 B
225 B 235ms
227ms Image
image/png 216.219.95.231
IS-AS-1

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/images/menu.png
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 216.219.95.231 , United States, ASN19318 (IS-AS-1, US),
Reverse DNS: vps.viewliveevents.in
Software: LiteSpeed /
Resource Hash: 45748637407a98f88b7f018df62ac8c0a8dd4743b39f0d8f4a64143c498161a5

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:16:21 GMT
last-modified: Sat, 09 Sep 2023 12:56:42 GMT
server: LiteSpeed
etag: "80-64fc6b8a-164385b3;;;"
content-type: image/png
cache-control: public, max-age=604800
accept-ranges: bytes
alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"
content-length: 128
expires: Sat, 06 Apr 2024 01:16:21 GMT

GET
H2 200 min.css
d39c1tueofpvm6.cloudfront.net/viewliveevents/player/ 39 KB
10 KB 294ms
287ms Stylesheet
text/css 2600:9000:2209:c000:1f:8466:d380:21
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://d39c1tueofpvm6.cloudfront.net/viewliveevents/player/min.css
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2600:9000:2209:c000:1f:8466:d380:21 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS
Software: AmazonS3 /
Resource Hash: 91f94a3c7e05d1c1afd01260e88ebea5be6720ed3514c7a82bba96a33d4d6b21

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

x-amz-version-id: czTy5ClYhCvvd296SNLL.Q.ubNBPjF6l
content-encoding: gzip
via: 1.1 ae9634deb2e9d6f8d396fc6f1e0586fa.cloudfront.net (CloudFront)
date: Fri, 29 Mar 2024 12:05:05 GMT
last-modified: Wed, 09 Dec 2020 08:56:34 GMT
server: AmazonS3
x-amz-cf-pop: EWR53-P1
age: 50375
etag: W/"ef822e2bcbe77ffc84c312c3b62d0ba6"
vary: Accept-Encoding
x-amz-meta-sha256: 91f94a3c7e05d1c1afd01260e88ebea5be6720ed3514c7a82bba96a33d4d6b21
content-type: text/css
x-cache: Hit from cloudfront
x-amz-cf-id: Y6XmKbMBrJfagSGwpzjrMSifpLnqY0q4CXfCDzyH-evOitTNVCJt6g==
x-amz-meta-s3b-last-modified: 20201208T143824Z

GET
H2 200 video.min.js Show response
d39c1tueofpvm6.cloudfront.net/viewliveevents/player/ 483 KB
136 KB 190ms
176ms Script
application/javascript 2600:9000:2209:c000:1f:8466:d380:21
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://d39c1tueofpvm6.cloudfront.net/viewliveevents/player/video.min.js
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2600:9000:2209:c000:1f:8466:d380:21 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS
Software: AmazonS3 /
Resource Hash: 1f32f116118f986dd762a1a2606c3c1364c03df304c4afa7a59dba8ff9bcd50a

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

x-amz-version-id: 8H2VtZXXkvHJaL_g3MyluxijwODjHcU1
content-encoding: gzip
via: 1.1 ae9634deb2e9d6f8d396fc6f1e0586fa.cloudfront.net (CloudFront)
date: Fri, 29 Mar 2024 13:37:21 GMT
last-modified: Thu, 04 Mar 2021 07:47:17 GMT
server: AmazonS3
x-amz-cf-pop: EWR53-P1
age: 41941
etag: W/"0634bf9629dfae18b78ff810e90369f2"
vary: Accept-Encoding
x-amz-meta-sha256: b06693c82049b416700ebfc4f66456d9f7e8a825de895ec9a4c6e3c1e3dfdf4f
content-type: application/javascript
x-cache: Hit from cloudfront
x-amz-cf-id: 5uL2tmyFGp40CMqJjlR9HZEhC1mrcWN9wEni-RyZ4jdjBKIxXeLYMg==
x-amz-meta-s3b-last-modified: 20210304T074618Z

GET
H2 200 hjs.js Show response
d39c1tueofpvm6.cloudfront.net/viewliveevents/player/ 238 KB
72 KB 106ms
76ms Script
application/javascript 2600:9000:2209:c000:1f:8466:d380:21
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://d39c1tueofpvm6.cloudfront.net/viewliveevents/player/hjs.js
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2600:9000:2209:c000:1f:8466:d380:21 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS
Software: AmazonS3 /
Resource Hash: b7f07fd410c361437f8322395645a33d3b4358a69f0aede57dbda7b4f94dbe8b

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

x-amz-version-id: 1ahSom5GPpud5zYB8cz7QlX2etwpymFe
content-encoding: gzip
via: 1.1 ae9634deb2e9d6f8d396fc6f1e0586fa.cloudfront.net (CloudFront)
date: Fri, 29 Mar 2024 12:46:46 GMT
last-modified: Wed, 10 Mar 2021 13:17:46 GMT
server: AmazonS3
x-amz-cf-pop: EWR53-P1
age: 44976
etag: W/"93f6f5982ef85df4574e45023a30c8b8"
vary: Accept-Encoding
x-amz-meta-sha256: b7f07fd410c361437f8322395645a33d3b4358a69f0aede57dbda7b4f94dbe8b
content-type: application/javascript
x-cache: Hit from cloudfront
x-amz-cf-id: 0PvDzdoEo_FencYt6rzqDvp856rbiu_C-5Bq8aNMk9hTtwGTTouBWQ==
x-amz-meta-s3b-last-modified: 20210310T131735Z

GET
H3 200 counter.gif
jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ 610 B
676 B 148ms
134ms Image
image/gif 216.219.95.231
IS-AS-1

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/counter.gif
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H3
Security: QUIC, , AES_128_GCM
Server: 216.219.95.231 , United States, ASN19318 (IS-AS-1, US),
Reverse DNS: vps.viewliveevents.in
Software: LiteSpeed /
Resource Hash: e714a355bf49cce7b25d53b7f773a44b2762ad804d2a91b5cc3f0f2d97b973b0

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:16:21 GMT
last-modified: Sat, 09 Sep 2023 12:56:40 GMT
server: LiteSpeed
etag: "262-64fc6b88-15040765;;;"
content-type: image/gif
cache-control: public, max-age=604800
accept-ranges: bytes
alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"
content-length: 610
expires: Sat, 06 Apr 2024 01:16:21 GMT

GET
H3 200 Maruthi%20Edit%20Point.jpg
jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/invitationuploads/ 406 KB
407 KB 143ms
124ms Image
image/jpeg 216.219.95.231
IS-AS-1

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/invitationuploads/Maruthi%20Edit%20Point.jpg
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H3
Security: QUIC, , AES_128_GCM
Server: 216.219.95.231 , United States, ASN19318 (IS-AS-1, US),
Reverse DNS: vps.viewliveevents.in
Software: LiteSpeed /
Resource Hash: 72a4c487e9ba6a85f801e702bac513851d6e74d12bc1bfcda65854d831e2bf8c

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:16:21 GMT
last-modified: Fri, 29 Mar 2024 18:34:28 GMT
server: LiteSpeed
etag: "658aa-660709b4-47f0d6;;;"
content-type: image/jpeg
cache-control: public, max-age=604800
accept-ranges: bytes
alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"
content-length: 415914
expires: Sat, 06 Apr 2024 01:16:21 GMT

GET
H2 200 js15_as.js Show response
s10.histats.com/ 11 KB
5 KB 216ms
51ms Script
text/javascript 2606:4700:10::6814:4373
CLOUDFLARENET

General

Check archive.org

Show headers Download Go to

Full URL: https://s10.histats.com/js15_as.js
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2606:4700:10::6814:4373 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software: cloudflare /
Resource Hash: 2defe59e357a7d0683c8283ac42841db404a0884cae2eaecebf4b676e559dede

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:16:21 GMT
content-encoding: gzip
cf-cache-status: HIT
last-modified: Thu, 16 Apr 2020 10:44:16 GMT
server: cloudflare
age: 67012
etag: "-375139978"
vary: Accept-Encoding
content-type: text/javascript
cache-control: max-age=28800
accept-ranges: bytes
cf-ray: 86c440fc18f86dbb-MIA
content-length: 4547

GET
H2 200 services-main-bg.jpg
d39c1tueofpvm6.cloudfront.net/dev/netliveassets/designs/wedding-4/images/ 3 KB
4 KB 131ms
111ms Image
image/jpeg 2600:9000:2209:c000:1f:8466:d380:21
AMAZON-02

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/designs/wedding-4/images/services-main-bg.jpg
Requested by: Host: d39c1tueofpvm6.cloudfront.net
URL: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/designs/wedding-4/style.css
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2600:9000:2209:c000:1f:8466:d380:21 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS
Software: AmazonS3 /
Resource Hash: f3a29e09317f5d798f40757b353629ad44d67b82032b430aec17be6424f6325b

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/designs/wedding-4/style.css
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

x-amz-version-id: RR9laUKiTIDQ0DF8QpmUqjCJTHhlyh5U
date: Sat, 30 Mar 2024 01:11:09 GMT
via: 1.1 ae9634deb2e9d6f8d396fc6f1e0586fa.cloudfront.net (CloudFront)
x-amz-cf-pop: EWR53-P1
age: 3562
x-amz-meta-sha256: f3a29e09317f5d798f40757b353629ad44d67b82032b430aec17be6424f6325b
x-cache: Hit from cloudfront
content-length: 3450
last-modified: Tue, 23 Feb 2021 05:40:10 GMT
server: AmazonS3
etag: "6c63e19dd16e2056533c43cdba6ebde8"
vary: Accept-Encoding
content-type: image/jpeg
accept-ranges: bytes
x-amz-cf-id: Cfebcd9ijG7a9No3n8DH3qWE_TiAlVuNXflkU-NEqvxqtKe1dDL5WQ==
x-amz-meta-s3b-last-modified: 20210206T124914Z

GET
H2 200 banner-bg.jpg
d39c1tueofpvm6.cloudfront.net/dev/netliveassets/designs/wedding-4/images/ 36 KB
36 KB 131ms
112ms Image
image/jpeg 2600:9000:2209:c000:1f:8466:d380:21
AMAZON-02

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/designs/wedding-4/images/banner-bg.jpg
Requested by: Host: d39c1tueofpvm6.cloudfront.net
URL: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/designs/wedding-4/style.css
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2600:9000:2209:c000:1f:8466:d380:21 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS
Software: AmazonS3 /
Resource Hash: 7434e264045ea93d86272cc9aeea1d0aa03e11bd49f658789b19d86f28136ace

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/designs/wedding-4/style.css
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

x-amz-version-id: dSOz4WRo2xHGWLuqn4110ulZyuPfUkdV
date: Sat, 30 Mar 2024 01:05:40 GMT
via: 1.1 ae9634deb2e9d6f8d396fc6f1e0586fa.cloudfront.net (CloudFront)
x-amz-cf-pop: EWR53-P1
age: 642
x-amz-meta-sha256: 7434e264045ea93d86272cc9aeea1d0aa03e11bd49f658789b19d86f28136ace
x-cache: Hit from cloudfront
content-length: 36677
last-modified: Tue, 23 Feb 2021 05:30:20 GMT
server: AmazonS3
etag: "4485f9adda242c9f73ef19d4b459598d"
vary: Accept-Encoding
content-type: image/jpeg
accept-ranges: bytes
x-amz-cf-id: MbdHfUs8OyX_GIM3lsV3O5sAA94ajYOFTGYNy1A4L3ukm5QOiBSy4w==
x-amz-meta-s3b-last-modified: 20210206T124640Z

GET
H2 200 opensans-regular-webfont.woff
d39c1tueofpvm6.cloudfront.net/dev/netliveassets/css/fonts/ 24 KB
25 KB 252ms
89ms Font
application/octet-stream 2600:9000:2209:c000:1f:8466:d380:21
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/css/fonts/opensans-regular-webfont.woff
Requested by: Host: d39c1tueofpvm6.cloudfront.net
URL: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/css/allstyles.css
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2600:9000:2209:c000:1f:8466:d380:21 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS
Software: AmazonS3 /
Resource Hash: 834c49499fc3b4668a0e3a327ff90fd92bda0206103d2aaf3e6d15d29f5277b9

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/css/allstyles.css
Origin: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:05:40 GMT
x-amz-version-id: 2taqtNITLI6OvyzTWWIeMIEjswXzjOlf
via: 1.1 0146c8129cacdacca96753291cf27ec4.cloudfront.net (CloudFront)
x-amz-cf-pop: EWR53-P1
age: 642
x-amz-meta-sha256: 834c49499fc3b4668a0e3a327ff90fd92bda0206103d2aaf3e6d15d29f5277b9
x-cache: Hit from cloudfront
content-length: 24788
last-modified: Sat, 06 Feb 2021 12:18:50 GMT
server: AmazonS3
etag: "ea91bc166b3de9218d3233035f8d8826"
vary: Origin
access-control-allow-methods: GET
content-type: application/octet-stream
access-control-allow-origin: *
accept-ranges: bytes
x-amz-cf-id: n-cgz1HzVK2pd6j6XN85LNWeJL_ZzBNk32Lsy4H61XsbdxM4ZrGoeA==
x-amz-meta-s3b-last-modified: 20170709T160853Z

GET
H2 200 Redressed-Regular.ttf
d39c1tueofpvm6.cloudfront.net/dev/netliveassets/designs/wedding-4/fonts/ 65 KB
36 KB 252ms
90ms Font
application/x-font-ttf 2600:9000:2209:c000:1f:8466:d380:21
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/designs/wedding-4/fonts/Redressed-Regular.ttf
Requested by: Host: d39c1tueofpvm6.cloudfront.net
URL: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/designs/wedding-4/style.css
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2600:9000:2209:c000:1f:8466:d380:21 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS
Software: AmazonS3 /
Resource Hash: 52e8c50e4b27e18e3793d48c223fa585529626eea9658db36ad5acd1e866ff6f

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/designs/wedding-4/style.css
Origin: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 29 Mar 2024 22:04:24 GMT
x-amz-version-id: CFtjDakbTWFUs1DH3jR2oCQNWV5fymnF
content-encoding: gzip
via: 1.1 0146c8129cacdacca96753291cf27ec4.cloudfront.net (CloudFront)
x-amz-cf-pop: EWR53-P1
age: 11518
x-amz-meta-sha256: 52e8c50e4b27e18e3793d48c223fa585529626eea9658db36ad5acd1e866ff6f
x-cache: Hit from cloudfront
last-modified: Tue, 23 Feb 2021 05:30:20 GMT
server: AmazonS3
etag: W/"2e77f3ad512293f58919ff7e3356bbc1"
vary: Accept-Encoding,Origin
access-control-allow-methods: GET
content-type: application/x-font-ttf
access-control-allow-origin: *
x-amz-cf-id: Z55-JnL98Jb5p0Rd8JU3ZRUdhDdwr8iTQAgKuYTu9iVej_bGsMgCEg==
x-amz-meta-s3b-last-modified: 20210127T233626Z

GET
H2 200 Arellion.ttf
d39c1tueofpvm6.cloudfront.net/dev/netliveassets/designs/wedding-4/fonts/ 243 KB
71 KB 319ms
157ms Font
application/x-font-ttf 2600:9000:2209:c000:1f:8466:d380:21
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/designs/wedding-4/fonts/Arellion.ttf
Requested by: Host: d39c1tueofpvm6.cloudfront.net
URL: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/designs/wedding-4/style.css
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2600:9000:2209:c000:1f:8466:d380:21 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS
Software: AmazonS3 /
Resource Hash: 43b6f7fc9d6dc4829c4d965ea45257e8cd987e145f080db398007680255f63bd

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://d39c1tueofpvm6.cloudfront.net/dev/netliveassets/designs/wedding-4/style.css
Origin: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 29 Mar 2024 22:04:24 GMT
x-amz-version-id: _5IkTQZhWfmwTCkkx0RTig.S7vxnyniw
content-encoding: gzip
via: 1.1 0146c8129cacdacca96753291cf27ec4.cloudfront.net (CloudFront)
x-amz-cf-pop: EWR53-P1
age: 11518
x-amz-meta-sha256: 43b6f7fc9d6dc4829c4d965ea45257e8cd987e145f080db398007680255f63bd
x-cache: Hit from cloudfront
last-modified: Tue, 23 Feb 2021 05:38:34 GMT
server: AmazonS3
etag: W/"55ea141144aa58dfb31dd0d98f80c844"
vary: Accept-Encoding,Origin
access-control-allow-methods: GET
content-type: application/x-font-ttf
access-control-allow-origin: *
x-amz-cf-id: YcZGfV2dMVsXbs7PwJCUhMHdQ9IWYlWfcpt0VueB6tjIPtSDHlB4gw==
x-amz-meta-s3b-last-modified: 20210129T031512Z

GET
BLOB 200
OK 1d2beade-2679-4caa-a91a-7d895daa9d70
https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ 31 B
0 Other
application/javascript

General

Check archive.org

Show headers Download Go to

Full URL: blob:https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/1d2beade-2679-4caa-a91a-7d895daa9d70
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: BLOB
Server: -, , ASN (),
Reverse DNS
Software: /
Resource Hash: 7725538fe2f71147bffeba7452b434c826aef9009666cb4360c605d0b2a91d1d

Request headers

accept-language: en-US,en;q=0.9
Referer
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

Content-Length: 31
Content-Type: application/javascript

GET
DATA 200
OK truncated
/ 380 B
0 Image
image/svg+xml

General

Check archive.org

Show headers Download Go to Show image

Full URL: data:truncated
Protocol: DATA
Server: -, , ASN (),
Reverse DNS
Software: /
Resource Hash: 717f6bb5f6cc69c444f54376a72dee0ca7968b2a12e7c9475247ec85c0e75a53

Request headers

accept-language: en-US,en;q=0.9
Referer
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

Content-Type: image/svg+xml

GET
DATA 200
OK truncated
/ 177 B
0 Image
image/svg+xml

General

Check archive.org

Show headers Download Go to Show image

Full URL: data:truncated
Protocol: DATA
Server: -, , ASN (),
Reverse DNS
Software: /
Resource Hash: d692a67352a3dfa80010c86a62761cfff05c0b1086618106a8576cc45a6a8115

Request headers

accept-language: en-US,en;q=0.9
Referer
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

Content-Type: image/svg+xml

GET
DATA 200
OK truncated
/ 351 B
0 Image
image/svg+xml

General

Check archive.org

Show headers Download Go to Show image

Full URL: data:truncated
Protocol: DATA
Server: -, , ASN (),
Reverse DNS
Software: /
Resource Hash: 145287b36883dd3061ca7aa9229a8fa9ace2cccd50e0382b4b6201f3916b57c5

Request headers

accept-language: en-US,en;q=0.9
Referer
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

Content-Type: image/svg+xml

GET
DATA 200
OK truncated
/ 242 B
0 Image
image/svg+xml

General

Check archive.org

Show headers Download Go to Show image

Full URL: data:truncated
Protocol: DATA
Server: -, , ASN (),
Reverse DNS
Software: /
Resource Hash: 1f4513a435d6a3047d20a50c1e7d4263de42146c74be227f774b5e82e6357e75

Request headers

accept-language: en-US,en;q=0.9
Referer
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

Content-Type: image/svg+xml

GET
DATA 200
OK truncated
/ 4 KB
4 KB Font
application/font-woff

General

Check archive.org

Show headers Download Go to

Full URL: data:truncated
Protocol: DATA
Server: -, , ASN (),
Reverse DNS
Software: /
Resource Hash: 4735c4e647a5fbf02419108212b4a35c4462430a862cc3d30577eb2e6eb7d9d9

Request headers

Referer
Origin: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
accept-language: en-US,en;q=0.9
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

Content-Type: application/font-woff;charset=utf-8

GET
H/1.1 404
Not Found playlist_dvr.m3u8 Show response
voddvrcdn.viewliveevents.in/voddvr/jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ 72 B
355 B 1540ms
152ms XHR
text/html 5.75.143.77
HETZNER-AS

General

Check archive.org

Show headers Download Go to

Full URL: https://voddvrcdn.viewliveevents.in/voddvr/jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/playlist_dvr.m3u8
Requested by: Host: d39c1tueofpvm6.cloudfront.net
URL: https://d39c1tueofpvm6.cloudfront.net/viewliveevents/player/hjs.js
Protocol: HTTP/1.1
Security: TLS 1.2, ECDHE_RSA, AES_128_GCM
Server: 5.75.143.77 Schöneiche, Germany, ASN24940 (HETZNER-AS, DE),
Reverse DNS: static.77.143.75.5.clients.your-server.de
Software: Nimble/3.7.13-3 /
Resource Hash: ee13bc196aa9b9aaf12a903311c994b943e02bf0e2b18128f4196e1b51a058e2

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

Date: Sat, 30 Mar 2024 01:16:23 GMT
Server: Nimble/3.7.13-3
Content-Type: text/html
Access-Control-Allow-Origin: *
Access-Control-Expose-Headers: Content-Length, Content-Range
Connection: close
Access-Control-Allow-Headers: Range
Content-Length: 72

GET
H/1.1 200
OK 0.php Show response
s4.histats.com/stats/ 379 B
514 B 228ms
74ms Script
text/html 149.56.240.127
OVH

General

Check archive.org

Show headers Download Go to

Full URL: https://s4.histats.com/stats/0.php?3793781&@f16&@g1&@h1&@i1&@j1711761382058&@k0&@l1&@mLIVE%3A%20Jahnavi%20with%20Saathwik%20Samala&@n0&@o1000&@q0&@r0&@s0&@ten-US&@u800&@b1:-105457320&@b3:1711761382&@b4:js15_as.js&@b5:-600&@a-_0.2.1&@vhttps%3A%2F%2Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%2F&@w
Requested by: Host: s10.histats.com
URL: https://s10.histats.com/js15_as.js
Protocol: HTTP/1.1
Security: TLS 1.2, ECDHE_RSA, AES_128_GCM
Server: 149.56.240.127 Montreal, Canada, ASN16276 (OVH, FR),
Reverse DNS: ns534295.ip-149-56-240.net
Software: /
Resource Hash: 2e35407520113047f4d0ab1680ecf94a285113dfcb475b4c349399335e493979

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

Date: Sat, 30 Mar 2024 01:16:22 GMT
Connection: close
Content-Length: 379
Content-Type: text/html;charset=UTF-8

GET
H2 200 js Show response
www.googletagmanager.com/gtag/ 304 KB
101 KB 91ms
87ms Script
application/javascript 2607:f8b0:4002:c0f::61
GOOGLE

General

Check archive.org

Show headers Download Go to

Full URL

https://www.googletagmanager.com/gtag/js?id=G-8GWGMS9S2Q&l=dataLayer&cx=c

Requested by

Host: www.googletagmanager.com
URL: https://www.googletagmanager.com/gtag/js?id=UA-25105023-19

Protocol

Security

TLS 1.3, , AES_128_GCM

Server

2607:f8b0:4002:c0f::61 Atlanta, United States, ASN15169 (GOOGLE, US),

Reverse DNS

Software

Google Tag Manager /

Resource Hash

3e10785d98d186776a472de99e3efc2537b3be807655ba39a9d61880df628e12

Security Headers

Name	Value
Strict-Transport-Security	max-age=31536000; includeSubDomains
X-Xss-Protection	0

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:16:22 GMT
content-encoding: br
strict-transport-security: max-age=31536000; includeSubDomains
server: Google Tag Manager
vary: Accept-Encoding
content-type: application/javascript; charset=UTF-8
access-control-allow-origin: *
cache-control: private, max-age=900
access-control-allow-credentials: true
cross-origin-resource-policy: cross-origin
access-control-allow-headers: Cache-Control
content-length: 103540
x-xss-protection: 0
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
expires: Sat, 30 Mar 2024 01:16:22 GMT

GET
H2 200 analytics.js Show response
www.google-analytics.com/ 52 KB
21 KB 137ms
42ms Script
text/javascript 2001:4860:4802:32::178
GOOGLE

General

Check archive.org

Show headers Download Go to

Full URL

https://www.google-analytics.com/analytics.js

Requested by

Host: www.googletagmanager.com
URL: https://www.googletagmanager.com/gtag/js?id=UA-25105023-19

Protocol

Security

TLS 1.3, , AES_128_GCM

Server

2001:4860:4802:32::178 , United States, ASN15169 (GOOGLE, US),

Reverse DNS

Software

Golfe2 /

Resource Hash

de36e50194320a7d3ef1ace9bd34a875a8bd458b253c061979dd628e9bf49afd

Security Headers

Name	Value
Strict-Transport-Security	max-age=10886400; includeSubDomains; preload
X-Content-Type-Options	nosniff

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

strict-transport-security: max-age=10886400; includeSubDomains; preload
content-encoding: gzip
x-content-type-options: nosniff
date: Fri, 29 Mar 2024 23:31:47 GMT
last-modified: Tue, 12 Dec 2023 18:09:08 GMT
server: Golfe2
age: 6275
vary: Accept-Encoding
content-type: text/javascript
cache-control: public, max-age=7200
cross-origin-resource-policy: cross-origin
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
content-length: 20994
expires: Sat, 30 Mar 2024 01:31:47 GMT

POST
H2 204 collect
analytics.google.com/g/ 0
278 B 793ms
45ms Ping
text/plain 2001:4860:4802:32::181
GOOGLE

General

Check archive.org

Show headers Download Go to

Full URL: https://analytics.google.com/g/collect?v=2&tid=G-8GWGMS9S2Q&gtm=45je43r0v896720582za200&_p=1711761381585&_gaz=1&gcd=13l3l3l3l1&npa=0&dma=0&cid=2049877075.1711761382&ul=en-us&sr=800x600&uaa=x86&uab=64&uafvl=Google%2520Chrome%3B123.0.6312.86%7CNot%253AA-Brand%3B8.0.0.0%7CChromium%3B123.0.6312.86&uamb=0&uam=&uap=Win32&uapv=10.0.0&uaw=0&pscdl=noapi&_eu=AAAI&_s=1&sid=1711761382&sct=1&seg=0&dl=https%3A%2F%2Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%2F&dt=LIVE%3A%20Jahnavi%20with%20Saathwik%20Samala&en=page_view&_fv=1&_nsi=1&_ss=1&tfd=2017
Requested by: Host: www.googletagmanager.com
URL: https://www.googletagmanager.com/gtag/js?id=G-8GWGMS9S2Q&l=dataLayer&cx=c
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2001:4860:4802:32::181 , United States, ASN15169 (GOOGLE, US),
Reverse DNS
Software: Golfe2 /
Resource Hash: e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

pragma: no-cache
date: Sat, 30 Mar 2024 01:16:23 GMT
server: Golfe2
content-type: text/plain
access-control-allow-origin: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
cache-control: no-cache, no-store, must-revalidate
access-control-allow-credentials: true
cross-origin-resource-policy: cross-origin
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
content-length: 0
expires: Fri, 01 Jan 1990 00:00:00 GMT

POST
H2 204 collect
stats.g.doubleclick.net/g/ 0
47 B 812ms
58ms Ping
text/plain 2607:f8b0:4002:c1b::9d
GOOGLE

General

Check archive.org

Show headers Download Go to

Full URL: https://stats.g.doubleclick.net/g/collect?v=2&tid=G-8GWGMS9S2Q&cid=2049877075.1711761382&gtm=45je43r0v896720582za200&aip=1&dma=0&gcd=13l3l3l3l1&npa=0
Requested by: Host: www.googletagmanager.com
URL: https://www.googletagmanager.com/gtag/js?id=G-8GWGMS9S2Q&l=dataLayer&cx=c
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2607:f8b0:4002:c1b::9d Atlanta, United States, ASN15169 (GOOGLE, US),
Reverse DNS
Software: Golfe2 /
Resource Hash: e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

pragma: no-cache
date: Sat, 30 Mar 2024 01:16:23 GMT
server: Golfe2
content-type: text/plain
access-control-allow-origin: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
cache-control: no-cache, no-store, must-revalidate
access-control-allow-credentials: true
cross-origin-resource-policy: cross-origin
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
content-length: 0
expires: Fri, 01 Jan 1990 00:00:00 GMT

POST
H2 200 collect Show response
www.google-analytics.com/j/ 2 B
231 B 46ms
45ms XHR
text/plain 2001:4860:4802:32::178
GOOGLE

General

Check archive.org

Show headers Download Go to

Full URL

https://www.google-analytics.com/j/collect?v=1&_v=j101&a=130038082&t=pageview&_s=1&dl=https%3A%2F%2Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%2F&ul=en-us&de=UTF-8&dt=LIVE%3A%20Jahnavi%20with%20Saathwik%20Samala&sd=24-bit&sr=800x600&vp=1600x1113&je=0&_u=YADAAUABAAAAACAAI~&jid=2135961940&gjid=561468084&cid=2049877075.1711761382&tid=UA-25105023-19&_gid=1551660678.1711761383&_r=1&gtm=457e43r0za200&gcd=13l3l3l3l1&dma=0&jsscut=1&z=394146846

Requested by

Host: www.google-analytics.com
URL: https://www.google-analytics.com/analytics.js

Protocol

Security

TLS 1.3, , AES_128_GCM

Server

2001:4860:4802:32::178 , United States, ASN15169 (GOOGLE, US),

Reverse DNS

Software

Golfe2 /

Resource Hash

de3246094525b21a870fc7d2a67490d0132535c6fa5993755c549f1a9d1bd8af

Security Headers

Name	Value
X-Content-Type-Options	nosniff

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-platform: "Win32"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
Content-Type: text/plain

Response headers

pragma: no-cache
date: Sat, 30 Mar 2024 01:16:22 GMT
x-content-type-options: nosniff
last-modified: Sun, 17 May 1998 03:00:00 GMT
server: Golfe2
content-type: text/plain
access-control-allow-origin: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
cache-control: no-cache, no-store, must-revalidate
access-control-allow-credentials: true
cross-origin-resource-policy: cross-origin
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
content-length: 2
expires: Fri, 01 Jan 1990 00:00:00 GMT

GET
H2 200 / Show response
e.dtscout.com/e/ 7 KB
4 KB 939ms
262ms Script
application/javascript 2606:4700:21::8d65:780b
CLOUDFLARENET

General

Check archive.org

Show headers Download Go to

Full URL: https://e.dtscout.com/e/?v=1a&pid=5200&site=1&l=https%3A%2F%2Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%2F&j=
Requested by: Host: s4.histats.com
URL: https://s4.histats.com/stats/0.php?3793781&@f16&@g1&@h1&@i1&@j1711761382058&@k0&@l1&@mLIVE%3A%20Jahnavi%20with%20Saathwik%20Samala&@n0&@o1000&@q0&@r0&@s0&@ten-US&@u800&@b1:-105457320&@b3:1711761382&@b4:js15_as.js&@b5:-600&@a-_0.2.1&@vhttps%3A%2F%2Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%2F&@w
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2606:4700:21::8d65:780b , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software: cloudflare /
Resource Hash: 4cf840b394056ee36af233641990167f4c9a41292f42318c1da5b1bc5ed68d76

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:16:23 GMT
x-t: 0.243
content-encoding: br
cf-cache-status: DYNAMIC
nel: {"success_fraction":0,"report_to":"cf-nel","max_age":604800}
server: cloudflare
report-to: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report\/v4?s=tJA4nEDsXjy52MyT1rqrVUIHAycnuj%2B0sjoIyCejgvmNPkvn%2F1cH%2Fs3%2F%2BGOMAba67%2FFA753YHNzVBhywO9fEpytwAz%2FdbSyrHH7nl9KDLRJ0OQ57c4ptsV6XgkF3E0npjGuobBmKJ6p0sp8%3D"}],"group":"cf-nel","max_age":604800}
content-type: application/javascript
cache-control: no-cache
x-s: ger1
cf-ray: 86c44105cd7c3370-MIA
expires: Sat, 30 Mar 2024 01:16:22 GMT

POST
H2 200 collect Show response
stats.g.doubleclick.net/j/ 2 B
371 B 107ms
58ms XHR
text/plain 2607:f8b0:4002:c1b::9d
GOOGLE

General

Check archive.org

Show headers Download Go to

Full URL

https://stats.g.doubleclick.net/j/collect?t=dc&aip=1&_r=3&v=1&_v=j101&tid=UA-25105023-19&cid=2049877075.1711761382&jid=2135961940&gjid=561468084&_gid=1551660678.1711761383&_u=YADAAUAAAAAAACAAI~&z=1999393361

Requested by

Host: www.google-analytics.com
URL: https://www.google-analytics.com/analytics.js

Protocol

Security

TLS 1.3, , AES_128_GCM

Server

2607:f8b0:4002:c1b::9d Atlanta, United States, ASN15169 (GOOGLE, US),

Reverse DNS

Software

Golfe2 /

Resource Hash

6068f86ff5e6d3a3e100e95fd0ab03a5fb9ebfca9386b2c0ee131361a62526c2

Security Headers

Name	Value
Strict-Transport-Security	max-age=10886400; includeSubDomains; preload
X-Content-Type-Options	nosniff

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-platform: "Win32"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
Content-Type: text/plain

Response headers

pragma: no-cache
strict-transport-security: max-age=10886400; includeSubDomains; preload
date: Sat, 30 Mar 2024 01:16:23 GMT
x-content-type-options: nosniff
last-modified: Sun, 17 May 1998 03:00:00 GMT
server: Golfe2
content-type: text/plain
access-control-allow-origin: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
cache-control: no-cache, no-store, must-revalidate
access-control-allow-credentials: true
cross-origin-resource-policy: cross-origin
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
content-length: 2
expires: Fri, 01 Jan 1990 00:00:00 GMT

GET
H3 200 ga-audiences
www.google.com/ads/ 42 B
63 B 551ms
53ms Image
image/gif 64.233.185.99
GOOGLE

General

Check archive.org

Show headers Download Go to Show image

Full URL

https://www.google.com/ads/ga-audiences?t=sr&aip=1&_r=4&slf_rd=1&v=1&_v=j101&tid=UA-25105023-19&cid=2049877075.1711761382&jid=2135961940&_u=YADAAUAAAAAAACAAI~&z=88944038

Requested by

Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/

Protocol

Security

QUIC, , AES_128_GCM

Server

64.233.185.99 , United States, ASN15169 (GOOGLE, US),

Reverse DNS

yb-in-f99.1e100.net

Software

cafe /

Resource Hash

ef1955ae757c8b966c83248350331bd3a30f658ced11f387f8ebf05ab3368629

Security Headers

Name	Value
X-Content-Type-Options	nosniff
X-Xss-Protection	0

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

pragma: no-cache
date: Sat, 30 Mar 2024 01:16:23 GMT
x-content-type-options: nosniff
server: cafe
content-type: image/gif
p3p: policyref="https://www.googleadservices.com/pagead/p3p.xml", CP="NOI DEV PSA PSD IVA IVD OTP OUR OTR IND OTC"
cache-control: no-cache, no-store, must-revalidate
cross-origin-resource-policy: cross-origin
timing-allow-origin: *
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
content-length: 42
x-xss-protection: 0
expires: Fri, 01 Jan 1990 00:00:00 GMT

GET
H2 200 /
t.dtscout.com/idg/ Frame BAB4 0
0 735ms
297ms Document
text/html 2606:4700:21::8d65:780b
CLOUDFLARENET

General

Check archive.org

Show headers Download Go to

Full URL: https://t.dtscout.com/idg/?su=51A01711761383C3AD6250C483A92E62
Requested by: Host: e.dtscout.com
URL: https://e.dtscout.com/e/?v=1a&pid=5200&site=1&l=https%3A%2F%2Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%2F&j=
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2606:4700:21::8d65:780b , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software: cloudflare /
Resource Hash

Request headers

Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Upgrade-Insecure-Requests: 1
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
accept-language: en-US,en;q=0.9
sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-mobile: ?0
sec-ch-ua-platform: "Win32"

Response headers

cache-control: no-cache
cf-cache-status: DYNAMIC
cf-ray: 86c4410bbc0ddb25-MIA
content-encoding: br
content-type: text/html; charset=UTF-8
date: Sat, 30 Mar 2024 01:16:24 GMT
expires: Sat, 30 Mar 2024 01:16:23 GMT
nel: {"success_fraction":0,"report_to":"cf-nel","max_age":604800}
report-to: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report\/v4?s=10CAXAAPEwHSrCs9Kxn%2FcecU%2BqPLUqrgDaM0wgI3xuS3zc%2BTOJ4WO2stEC%2BvSCwvmHZrU%2FTxkds0CJuNGtkFBPnrLELDStWlzbPwAIjAs3aC02ZN29XWnKSciYsd9SYGA38W9NKyYvUAn94%3D"}],"group":"cf-nel","max_age":604800}
server: cloudflare

GET
H2 200 tag.min.js Show response
get.s-onetag.com/f0c84061-4182-4398-8e37-5ff5b5698a6f/ 24 KB
8 KB 411ms
63ms Script
application/javascript 18.238.55.22
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://get.s-onetag.com/f0c84061-4182-4398-8e37-5ff5b5698a6f/tag.min.js
Requested by: Host: e.dtscout.com
URL: https://e.dtscout.com/e/?v=1a&pid=5200&site=1&l=https%3A%2F%2Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%2F&j=
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 18.238.55.22 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS: server-18-238-55-22.jfk52.r.cloudfront.net
Software: AmazonS3 /
Resource Hash: 8c8ce49ea0bca4a25c06125706d379cd2786025153ced2d4ddcf7a1a9f8a2972

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

x-amz-version-id: Pe6GIZEM6dgqeqUvm6LottgOapPgk7ue
content-encoding: gzip
via: 1.1 c49af0736096dd9eb595aafed0498ed4.cloudfront.net (CloudFront)
date: Fri, 29 Mar 2024 08:26:57 GMT
last-modified: Tue, 27 Feb 2024 18:38:56 GMT
server: AmazonS3
x-amz-cf-pop: JFK52-P4
age: 60567
x-amz-server-side-encryption: AES256
etag: W/"20ad935553b73dd8a08c669492e0a0a2"
vary: Accept-Encoding
x-cache: Hit from cloudfront
content-type: application/javascript
cache-control: max-age=86400
x-amz-cf-id: ihT3iRotS27sjVf7oKpXuYHoEgAP8CVFOSZGAd3Qds6acc_LwyTyRg==

GET
H/1.1 200
OK dtscout Show response
pd.sharethis.com/pd/ 2 KB
3 KB 481ms
67ms Script
application/javascript 3.19.195.77
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL

https://pd.sharethis.com/pd/dtscout

Requested by

Host: e.dtscout.com
URL: https://e.dtscout.com/e/?v=1a&pid=5200&site=1&l=https%3A%2F%2Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%2F&j=

Protocol

HTTP/1.1

Security

TLS 1.2, ECDHE_RSA, AES_128_GCM

Server

3.19.195.77 Columbus, United States, ASN16509 (AMAZON-02, US),

Reverse DNS

ec2-3-19-195-77.us-east-2.compute.amazonaws.com

Software

Resource Hash

621d6975d9231c0b51ce05afb7e1471de90ab3e1e658b0a231b55c819c98ef79

Security Headers

Name	Value
Strict-Transport-Security	max-age=63072000; includeSubDomains;

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

Date: Sat, 30 Mar 2024 01:16:24 GMT
Strict-Transport-Security: max-age=63072000; includeSubDomains;
Connection: keep-alive
X-Robots-Tag: noindex, nofollow
Content-Length: 2444
Content-Type: application/javascript

GET
H2 200 afwu.js Show response
cdn.tynt.com/ 19 KB
6 KB 389ms
50ms Script
application/javascript 172.64.153.173
CLOUDFLARENET

General

Check archive.org

Show headers Download Go to

Full URL: https://cdn.tynt.com/afwu.js
Requested by: Host: e.dtscout.com
URL: https://e.dtscout.com/e/?v=1a&pid=5200&site=1&l=https%3A%2F%2Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%2F&j=
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 172.64.153.173 San Francisco, United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software: cloudflare /
Resource Hash: 3db5fc063868d3ca5fc3cc2695f483266cffea00bef68dffd7e4944b947aacc8

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:16:23 GMT
content-encoding: gzip
cf-cache-status: HIT
last-modified: Thu, 05 Oct 2023 15:08:56 GMT
server: cloudflare
age: 235583
etag: W/"651ed188-4c00"
vary: Accept-Encoding
content-type: application/javascript
cache-control: public, max-age=259200
cf-ray: 86c44109ab9f9ae0-MIA
expires: Tue, 02 Apr 2024 01:16:23 GMT

GET
H2 200 / Show response
t.dtscout.com/pv/ 51 B
346 B 284ms
282ms Script
application/javascript 2606:4700:21::8d65:780b
CLOUDFLARENET

General

Check archive.org

Show headers Download Go to

Full URL: https://t.dtscout.com/pv/?_a=v&_h=jahnaviwithsaathwiksamala.appvideo.fcliveevents.in&_ss=1v1qqsx72w&_pv=1&_ls=0&_u1=1&_u3=1&_cc=us&_pl=d&_cbid=79b3&_cb=_dtspv.c
Requested by: Host: e.dtscout.com
URL: https://e.dtscout.com/e/?v=1a&pid=5200&site=1&l=https%3A%2F%2Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%2F&j=
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2606:4700:21::8d65:780b , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software: cloudflare /
Resource Hash: 6b67fa3f010bd41b15b11812c97dd1b7b3d03c5b88bc6c1c4f889eb62966069f

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:16:23 GMT
x-t: 0.159
content-encoding: br
cf-cache-status: DYNAMIC
nel: {"success_fraction":0,"report_to":"cf-nel","max_age":604800}
server: cloudflare
report-to: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report\/v4?s=v3uX9Bj92J1FEvqwLONkTgyoQsDO%2BAF5R3LpA%2BoLlQ%2BADdneq%2BsSK9pyXDokN2j6qs3k1Qs1k53VFCH20WbrGQHJ4%2BzVVS%2FOlJxCMWyUkiGAi3P5oI4Ruz9rKd4tuIWX5w9I2Mxlv8Dd5vk%3D"}],"group":"cf-nel","max_age":604800}
x-c: 0
content-type: application/javascript
cache-control: no-cache
cf-ray: 86c44107c9073370-MIA
expires: Sat, 30 Mar 2024 01:16:22 GMT

GET
H/1.1 404
Not Found playlist_dvr.m3u8 Show response
voddvrcdn.viewliveevents.in/voddvr/jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ 72 B
355 B 468ms
156ms XHR
text/html 5.75.143.77
HETZNER-AS

General

Check archive.org

Show headers Download Go to

Full URL: https://voddvrcdn.viewliveevents.in/voddvr/jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/playlist_dvr.m3u8
Requested by: Host: d39c1tueofpvm6.cloudfront.net
URL: https://d39c1tueofpvm6.cloudfront.net/viewliveevents/player/hjs.js
Protocol: HTTP/1.1
Security: TLS 1.2, ECDHE_RSA, AES_128_GCM
Server: 5.75.143.77 Schöneiche, Germany, ASN24940 (HETZNER-AS, DE),
Reverse DNS: static.77.143.75.5.clients.your-server.de
Software: Nimble/3.7.13-3 /
Resource Hash: ee13bc196aa9b9aaf12a903311c994b943e02bf0e2b18128f4196e1b51a058e2

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

Date: Sat, 30 Mar 2024 01:16:24 GMT
Server: Nimble/3.7.13-3
Content-Type: text/html
Access-Control-Allow-Origin: *
Access-Control-Expose-Headers: Content-Length, Content-Range
Connection: close
Access-Control-Allow-Headers: Range
Content-Length: 72

GET
H2 200 / Show response
onetag-geo.s-onetag.com/ 50 B
454 B 379ms
94ms Fetch
application/json 18.173.132.31
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://onetag-geo.s-onetag.com/
Requested by: Host: get.s-onetag.com
URL: https://get.s-onetag.com/f0c84061-4182-4398-8e37-5ff5b5698a6f/tag.min.js
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 18.173.132.31 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS: server-18-173-132-31.jfk52.r.cloudfront.net
Software: /
Resource Hash: 851a1aace07f995f5075846e18098478b6fe7c7e921e84747504ceb39f6a94b6

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:16:24 GMT
via: 1.1 5ea972e689f9b02c2fa2ba9f72e70ede.cloudfront.net (CloudFront), 1.1 0bec03027031f991ae9cc48b95f1b35c.cloudfront.net (CloudFront)
x-amz-cf-pop: IAD12-P4, JFK52-P2
x-amzn-requestid: a3bdca8a-f085-426b-86d0-30c1878a27b8
x-cache: Hit from cloudfront
content-type: application/json
access-control-allow-origin: *
cache-control: max-age=86400
x-amz-apigw-id: Va0sWHDLiYcEHPA=
content-length: 50
x-amz-cf-id: 2OuCKSprpkGyl05nQ8Aq69DDUl40OqTVx074BLerZu8OB8l-XhTd0A==

GET
H2 200 / Show response
onetag-geo.s-onetag.com/ 50 B
454 B 380ms
95ms Fetch
application/json 18.173.132.31
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://onetag-geo.s-onetag.com/
Requested by: Host: get.s-onetag.com
URL: https://get.s-onetag.com/f0c84061-4182-4398-8e37-5ff5b5698a6f/tag.min.js
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 18.173.132.31 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS: server-18-173-132-31.jfk52.r.cloudfront.net
Software: /
Resource Hash: 851a1aace07f995f5075846e18098478b6fe7c7e921e84747504ceb39f6a94b6

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:16:24 GMT
via: 1.1 5ea972e689f9b02c2fa2ba9f72e70ede.cloudfront.net (CloudFront), 1.1 0bec03027031f991ae9cc48b95f1b35c.cloudfront.net (CloudFront)
x-amz-cf-pop: IAD12-P4, JFK52-P2
x-amzn-requestid: a3bdca8a-f085-426b-86d0-30c1878a27b8
x-cache: Miss from cloudfront
content-type: application/json
access-control-allow-origin: *
cache-control: max-age=86400
x-amz-apigw-id: Va0sWHDLiYcEHPA=
content-length: 50
x-amz-cf-id: th6VAi3tlTEy06HBO06DLI7Q4bdPeYKawqFDzPIj29Ydr-7xCLoOsw==

GET
H2 200 p
ic.tynt.com/b/ 35 B
648 B 330ms
76ms Image
image/gif 67.202.105.32
STEADFAST

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://ic.tynt.com/b/p?id=wu!&lm=0&ts=1711761384042&dn=AFWU&iso=0&pu=https%3A%2F%2Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%2F&t=LIVE%3A%20Jahnavi%20with%20Saathwik%20Samala&chpv=10.0.0&chuav=Google%20Chrome%3Bv%3D123.0.6312.86%2C%20Not%3AA-Brand%3Bv%3D8.0.0.0%2C%20Chromium%3Bv%3D123.0.6312.86&chp=Win32&chmob=0&chua=Google%20Chrome%3Bv%3D123%2C%20Not%3AA-Brand%3Bv%3D8%2C%20Chromium%3Bv%3D123
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 67.202.105.32 , United States, ASN32748 (STEADFAST, US),
Reverse DNS: ip32.67-202-105.static.steadfastdns.net
Software: nginx/1.16.1 /
Resource Hash: 8337212354871836e6763a41e615916c89bac5b3f1f0adf60ba43c7c806e1015

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:16:24 GMT
last-modified: Fri, 16 Apr 2010 15:38:20 GMT
server: nginx/1.16.1
accept-ch: Sec-CH-UA-Platform, Sec-CH-UA-Platform-Version, Sec-CH-UA-Model, Sec-CH-UA-Full-Version-List, Sec-CH-UA, Sec-CH-UA-Mobile
etag: "4bc8846c-23"
content-type: image/gif
p3p: policyref="/w3c/p3p.xml", CP="CUR ADM OUR NOR STA NID", CP="NOI DSP COR NID PSA PSD OUR IND UNI COM NAV INT DEM STA"
cache-control: "no-store, no-cache, must-revalidate, post-check=0, pre-check=0, false"
accept-ranges: bytes
content-length: 35
expires: "Sat, 26 Jul 1997 05:00:00 GMT"

GET
H/1.1 200
OK t.dhj Show response
t.sharethis.com/1/d/ 2 KB
2 KB 297ms
69ms Script
application/javascript 23.198.214.73
AKAMAI-ASN1

General

Check archive.org

Show headers Download Go to

Full URL

https://t.sharethis.com/1/d/t.dhj?cid=c010&cls=C&rnd=0.7360854015082421&stid=ZGUAAmYHZ%2BgAAAAIA4SEAw%3D%3D

Requested by

Host: pd.sharethis.com
URL: https://pd.sharethis.com/pd/dtscout

Protocol

HTTP/1.1

Security

TLS 1.3, , AES_256_GCM

Server

23.198.214.73 Piscataway, United States, ASN20940 (AKAMAI-ASN1, NL),

Reverse DNS

a23-198-214-73.deploy.static.akamaitechnologies.com

Software

Resource Hash

e38dc477bf921713f2812cdeeae6657aac03d4a3b37d9db782feb9bc38421b5c

Security Headers

Name	Value
Strict-Transport-Security	max-age=2628000 ; includeSubDomains
X-Content-Type-Options	nosniff

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

Date: Sat, 30 Mar 2024 01:16:24 GMT
Content-Encoding: gzip
X-Content-Type-Options: nosniff
Strict-Transport-Security: max-age=2628000 ; includeSubDomains
Content-Type: application/javascript
Cache-Control: private, max-age=3600
Connection: keep-alive
X-Robots-Tag: noindex, nofollow
Content-Length: 1364
Expires: Sat, 30 Mar 2024 02:16:24 GMT

GET
H/1.1 200
OK dtscout
pd.sharethis.com/pd/ 42 B
265 B 72ms
72ms Image
image/gif 3.19.195.77
AMAZON-02

General

Check archive.org

Show headers Download Go to Show image

Full URL

https://pd.sharethis.com/pd/dtscout?_t_=px&url=https%3A%2F%2Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%2F&event_source=dtscout&rnd=0.7360854015082421&exptid=ZGUAAmYHZ%2BgAAAAIA4SEAw%3D%3D&fcmp=false

Requested by

Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/

Protocol

HTTP/1.1

Security

TLS 1.2, ECDHE_RSA, AES_128_GCM

Server

3.19.195.77 Columbus, United States, ASN16509 (AMAZON-02, US),

Reverse DNS

ec2-3-19-195-77.us-east-2.compute.amazonaws.com

Software

Resource Hash

ef1955ae757c8b966c83248350331bd3a30f658ced11f387f8ebf05ab3368629

Security Headers

Name	Value
Strict-Transport-Security	max-age=63072000; includeSubDomains;

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

Date: Sat, 30 Mar 2024 01:16:24 GMT
Strict-Transport-Security: max-age=63072000; includeSubDomains;
Connection: keep-alive
X-Robots-Tag: noindex, nofollow
Content-Length: 42
Content-Type: image/gif

GET
H2 200 v2 Show response
de.tynt.com/deb/ 1 KB
2 KB 249ms
83ms Script
application/javascript 67.202.105.31
STEADFAST

General

Check archive.org

Show headers Download Go to

Full URL: https://de.tynt.com/deb/v2?id=wu!&dn=AFWU&cc=1&chpv=10.0.0&chuav=Google%20Chrome%3Bv%3D123.0.6312.86%2C%20Not%3AA-Brand%3Bv%3D8.0.0.0%2C%20Chromium%3Bv%3D123.0.6312.86&chp=Win32&chmob=0&chua=Google%20Chrome%3Bv%3D123%2C%20Not%3AA-Brand%3Bv%3D8%2C%20Chromium%3Bv%3D123&r=&pu=https%3A%2F%2Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%2F
Requested by: Host: cdn.tynt.com
URL: https://cdn.tynt.com/afwu.js
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 67.202.105.31 , United States, ASN32748 (STEADFAST, US),
Reverse DNS: ip31.67-202-105.static.steadfastdns.net
Software: /
Resource Hash: 1633daaabd15713163bdacb40896cb75d3969d1a0007b55e7f0a05f5304fa228

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

p3p: CP="NOI DSP COR NID PSA PSD OUR IND UNI COM NAV INT DEM STA"
date: Sat, 30 Mar 2024 01:16:23 GMT
cache-control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0, false
content-type: application/javascript
accept-ch: Sec-CH-UA-Platform, Sec-CH-UA-Platform-Version, Sec-CH-UA-Model, Sec-CH-UA-Full-Version-List, Sec-CH-UA, Sec-CH-UA-Mobile
content-length: 1250
expires: Sat, 26 Jul 1997 05:00:00 GMT

GET
H/1.1 200
OK t_.htm
t.sharethis.com/a/ Frame FE7C 0
0 259ms
65ms Document
text/html 23.198.214.81
AKAMAI-ASN1

General

Check archive.org

Show headers Download Go to

Full URL

https://t.sharethis.com/a/t_.htm?ver=1.1325.23384&cid=c010&cls=C

Requested by

Host: t.sharethis.com
URL: https://t.sharethis.com/1/d/t.dhj?cid=c010&cls=C&rnd=0.7360854015082421&stid=ZGUAAmYHZ%2BgAAAAIA4SEAw%3D%3D

Protocol

HTTP/1.1

Security

TLS 1.3, , AES_256_GCM

Server

23.198.214.81 Piscataway, United States, ASN20940 (AKAMAI-ASN1, NL),

Reverse DNS

a23-198-214-81.deploy.static.akamaitechnologies.com

Software

Resource Hash

Security Headers

Name	Value
Strict-Transport-Security	max-age=2628000 ; includeSubDomains

Request headers

Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Upgrade-Insecure-Requests: 1
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
accept-language: en-US,en;q=0.9
sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-mobile: ?0
sec-ch-ua-platform: "Win32"

Response headers

Cache-Control: max-age=604800
Connection: keep-alive
Content-Encoding: gzip
Content-Length: 1160
Content-Type: text/html
Date: Sat, 30 Mar 2024 01:16:24 GMT
Expires: Sat, 06 Apr 2024 01:16:24 GMT
Strict-Transport-Security: max-age=2628000 ; includeSubDomains
X-Robots-Tag: noindex, nofollow

GET
H2 200 dataBeacons.min.js Show response
data-beacons.s-onetag.com/ 5 KB
2 KB 445ms
64ms Script
text/javascript 108.139.29.87
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://data-beacons.s-onetag.com/dataBeacons.min.js
Requested by: Host: get.s-onetag.com
URL: https://get.s-onetag.com/f0c84061-4182-4398-8e37-5ff5b5698a6f/tag.min.js
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 108.139.29.87 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS: server-108-139-29-87.jfk50.r.cloudfront.net
Software: AmazonS3 /
Resource Hash: e163818928211f02c67e6e681d6eaa2836d0b76bf6f7d788d2ac8b3559006cd1

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

x-amz-version-id: qPB_DsY9PcNoqTcQmlYVavIgcqbEMkpN
content-encoding: gzip
via: 1.1 d3a2886dcf7e47b1e56baf628c69dc24.cloudfront.net (CloudFront)
date: Sat, 30 Mar 2024 00:47:02 GMT
last-modified: Mon, 26 Feb 2024 21:11:41 GMT
server: AmazonS3
x-amz-cf-pop: JFK50-P2
age: 1763
etag: W/"55d68040e85314adc43d0fc5d17f0b10"
vary: Accept-Encoding
x-cache: Hit from cloudfront
content-type: text/javascript
cache-control: max-age=3600
x-amz-cf-id: RYys9ZQfvNfY_o05iIpMuFFsTZNdnR0VIjfyx20P5CpiDJrWxZWeJQ==

GET
H2 200 lotame-sync.html
cdn-tc.33across.com/ Frame 8890 0
0 244ms
39ms Document
text/html 104.18.35.167
CLOUDFLARENET

General

Check archive.org

Show headers Download Go to

Full URL: https://cdn-tc.33across.com/lotame-sync.html
Requested by: Host: de.tynt.com
URL: https://de.tynt.com/deb/v2?id=wu!&dn=AFWU&cc=1&chpv=10.0.0&chuav=Google%20Chrome%3Bv%3D123.0.6312.86%2C%20Not%3AA-Brand%3Bv%3D8.0.0.0%2C%20Chromium%3Bv%3D123.0.6312.86&chp=Win32&chmob=0&chua=Google%20Chrome%3Bv%3D123%2C%20Not%3AA-Brand%3Bv%3D8%2C%20Chromium%3Bv%3D123&r=&pu=https%3A%2F%2Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%2F
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 104.18.35.167 -, , ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software: cloudflare /
Resource Hash

Request headers

Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Upgrade-Insecure-Requests: 1
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
accept-language: en-US,en;q=0.9
sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-mobile: ?0
sec-ch-ua-platform: "Win32"

Response headers

age: 117576
cache-control: public, max-age=259200
cf-cache-status: HIT
cf-ray: 86c441101e2a74b6-MIA
content-encoding: gzip
content-type: text/html
date: Sat, 30 Mar 2024 01:16:24 GMT
etag: W/"651ed192-157"
expires: Tue, 02 Apr 2024 01:16:24 GMT
last-modified: Thu, 05 Oct 2023 15:09:06 GMT
server: cloudflare
vary: Accept-Encoding

GET
H2

204

/
lex.33across.com/ps/v1/pubtoken/
Redirect Chain

https://lex.33across.com/ps/v1/pubtoken/?pid=128&us_privacy=&rnd=1711761384492.1&ru=https%3A%2F%2Flive.rezync.com%2Fsync%3Fc%3D4656c20ee35215f78e9273796625d90b%26p%3Dcab5a4722e64fa65aba8e60b6da5d55...
https://lex.33across.com/ps/v1/pubtoken/?pid=128&us_privacy=&rnd=1711761384492.1&ru=https%3A%2F%2Flive.rezync.com%2Fsync%3Fc%3D4656c20ee35215f78e9273796625d90b%26p%3Dcab5a4722e64fa65aba8e60b6da5d55...

0
66 B

81ms
54ms

Image
text/plain

67.202.105.23
STEADFAST

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://lex.33across.com/ps/v1/pubtoken/?pid=128&us_privacy=&rnd=1711761384492.1&ru=https%3A%2F%2Flive.rezync.com%2Fsync%3Fc%3D4656c20ee35215f78e9273796625d90b%26p%3Dcab5a4722e64fa65aba8e60b6da5d556%26pcat%3D%26pdev%3D%26pctry%3DUS%26referrer%3Dhttps%253A%252F%252Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%252F%26us_privacy%3D%24%7BUS_PRIVACY%7D%26cache_buster%3D%24%7BRANDOM%7D%26custom1%3D%24%7BPUBTOK%7D&b=1
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Server: 67.202.105.23 , United States, ASN32748 (STEADFAST, US),
Reverse DNS: ip23.67-202-105.static.steadfastdns.net
Software: 33XP015 /
Resource Hash: e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855

Request headers

accept-language: en-US,en;q=0.9
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

x-33x-status: 8
date: Sat, 30 Mar 2024 01:16:24 GMT
server: 33XP015

Redirect headers

pragma: no-cache
date: Sat, 30 Mar 2024 01:16:24 GMT
referrer-policy: unsafe-url
server: 33XP012
x-33x-status: 8
location: https://lex.33across.com/ps/v1/pubtoken/?pid=128&us_privacy=&rnd=1711761384492.1&ru=https%3A%2F%2Flive.rezync.com%2Fsync%3Fc%3D4656c20ee35215f78e9273796625d90b%26p%3Dcab5a4722e64fa65aba8e60b6da5d556%26pcat%3D%26pdev%3D%26pctry%3DUS%26referrer%3Dhttps%253A%252F%252Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%252F%26us_privacy%3D%24%7BUS_PRIVACY%7D%26cache_buster%3D%24%7BRANDOM%7D%26custom1%3D%24%7BPUBTOK%7D&b=1
cache-control: no-store, no-cache, must-revalidate
content-length: 0
expires: Thu, 01-Jan-70 00:00:01 GMT

GET
H2

200

396846.gif
idsync.rlcdn.com/
Redirect Chain

https://rc.rlcdn.com/361726.gif?n=1&33random=1711761384492.2
https://rc.rlcdn.com/1000.gif?memo=CP6JFhoNCOjPnbAGEgUI6AcQAEIASgA
https://us-u.openx.net/w/1.0/cm?id=e508c905-ddce-4732-92a4-0b0f5b72a28f&r=https%3A%2F%2Fidsync.rlcdn.com%2F396846.gif%3Fserved_by%3Devergreen%26partner_uid%3D
https://us-u.openx.net/w/1.0/cm?cc=1&id=e508c905-ddce-4732-92a4-0b0f5b72a28f&r=https%3A%2F%2Fidsync.rlcdn.com%2F396846.gif%3Fserved_by%3Devergreen%26partner_uid%3D
https://idsync.rlcdn.com/396846.gif?served_by=evergreen&partner_uid=cfaad51a-55c2-4f55-94d2-14f88558095f

42 B
318 B

79ms
78ms

Image
image/gif

35.244.154.8
GOOGLE

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://idsync.rlcdn.com/396846.gif?served_by=evergreen&partner_uid=cfaad51a-55c2-4f55-94d2-14f88558095f
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Server: 35.244.154.8 Kansas City, United States, ASN15169 (GOOGLE, US),
Reverse DNS: 8.154.244.35.bc.googleusercontent.com
Software: /
Resource Hash: ef1955ae757c8b966c83248350331bd3a30f658ced11f387f8ebf05ab3368629

Request headers

accept-language: en-US,en;q=0.9
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

date: Sat, 30 Mar 2024 01:16:25 GMT
via: 1.1 google
content-type: image/gif
p3p: CP="NOI DSP COR NID CURa ADMa DEVa PSAa PSDa OUR BUS COM INT OTC PUR STA"
cache-control: no-cache, no-store
timing-allow-origin: *
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
content-length: 42

Redirect headers

date: Sat, 30 Mar 2024 01:16:25 GMT
content-encoding: gzip
via: 1.1 google
server: OXGW/0.0.0
vary: Accept, Accept-Encoding
content-type: image/gif
location: https://idsync.rlcdn.com/396846.gif?served_by=evergreen&partner_uid=cfaad51a-55c2-4f55-94d2-14f88558095f
p3p: CP="CUR ADM OUR NOR STA NID"
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
content-length: 0

GET
H2 200 dpx
i.simpli.fi/ 95 B
552 B 299ms
64ms Image
image/png 34.86.110.8
GOOGLE-CLOUD-PLAT...

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://i.simpli.fi/dpx?cid=11411&us_privacy=&33random=1711761384492.3&ref=
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Security: TLS 1.2, ECDHE_RSA, AES_256_GCM
Server: 34.86.110.8 Washington, United States, ASN396982 (GOOGLE-CLOUD-PLATFORM, US),
Reverse DNS: 8.110.86.34.bc.googleusercontent.com
Software: openresty /
Resource Hash: 3eb10792d1f0c7e07e7248273540f1952d9a5a2996f4b5df70ab026cd9f05517

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

pragma: no-cache
date: Sat, 30 Mar 2024 01:16:24 GMT
server: openresty
content-type: image/png; charset=utf-8
cache-control: max-age=0, private, must-revalidate, max-age=0, no-cache, no-store, private, must-revalidate, s-maxage=0
content-length: 95
x-request-id: F8Fl6QUGccMEuwqYhJJE
expires: Thu, 01 Jan 1970 00:00:00 GMT

GET
H2

200

sync
pippio.com/api/
Redirect Chain

https://rc.rlcdn.com/361726.gif?n=1&33random=1711761384492.5
https://pippio.com/api/sync?pid=5324&_=2

42 B
570 B

201ms
56ms

Image
image/gif

107.178.254.65
GOOGLE-CLOUD-PLAT...

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://pippio.com/api/sync?pid=5324&_=2
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Server: 107.178.254.65 Kansas City, United States, ASN396982 (GOOGLE-CLOUD-PLATFORM, US),
Reverse DNS: 65.254.178.107.bc.googleusercontent.com
Software: /
Resource Hash: ef1955ae757c8b966c83248350331bd3a30f658ced11f387f8ebf05ab3368629

Request headers

accept-language: en-US,en;q=0.9
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

date: Sat, 30 Mar 2024 01:16:25 GMT
via: 1.1 google
content-type: image/gif
p3p: CP="NOI DSP COR NID CURa ADMa DEVa PSAa PSDa OUR BUS COM INT OTC PUR STA"
cache-control: no-cache, no-store
timing-allow-origin: *
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
content-length: 42

Redirect headers

date: Sat, 30 Mar 2024 01:16:24 GMT
via: 1.1 google
p3p: CP="NOI DSP COR NID CURa ADMa DEVa PSAa PSDa OUR BUS COM INT OTC PUR STA"
location: https://pippio.com/api/sync?pid=5324&_=2
cache-control: no-cache, no-store
timing-allow-origin: *
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
content-length: 0

GET
H2 200 dpx
i.simpli.fi/ 95 B
552 B 293ms
59ms Image
image/png 34.86.110.8
GOOGLE-CLOUD-PLAT...

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://i.simpli.fi/dpx?cid=11411&us_privacy=&33random=1711761384492.6&ref=
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Security: TLS 1.2, ECDHE_RSA, AES_256_GCM
Server: 34.86.110.8 Washington, United States, ASN396982 (GOOGLE-CLOUD-PLATFORM, US),
Reverse DNS: 8.110.86.34.bc.googleusercontent.com
Software: openresty /
Resource Hash: 3eb10792d1f0c7e07e7248273540f1952d9a5a2996f4b5df70ab026cd9f05517

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

pragma: no-cache
date: Sat, 30 Mar 2024 01:16:24 GMT
server: openresty
content-type: image/png; charset=utf-8
cache-control: max-age=0, private, must-revalidate, max-age=0, no-cache, no-store, private, must-revalidate, s-maxage=0
content-length: 95
x-request-id: F8Fl6QUAz0YdipnHbUMB
expires: Thu, 01 Jan 1970 00:00:00 GMT

GET
H2 200 lt.min.js Show response
tags.crwdcntrl.net/lt/c/3825/ 58 KB
18 KB 254ms
75ms Script
text/javascript 108.138.128.34
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://tags.crwdcntrl.net/lt/c/3825/lt.min.js
Requested by: Host: e.dtscout.com
URL: https://e.dtscout.com/e/?v=1a&pid=5200&site=1&l=https%3A%2F%2Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%2F&j=
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 108.138.128.34 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS: server-108-138-128-34.jfk50.r.cloudfront.net
Software: AmazonS3 /
Resource Hash: e822cdbdb0e7f6a40fa06e5492b5d68c11ed3bd2523f5f40fed171e6ee18f3d7

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 29 Mar 2024 15:30:08 GMT
content-encoding: gzip
via: 1.1 ee6e7a840d56ceb3b04e8ddd420dab06.cloudfront.net (CloudFront)
last-modified: Wed, 14 Feb 2024 15:50:54 GMT
server: AmazonS3
x-amz-cf-pop: JFK50-P4
age: 35178
etag: W/"06c95ed0263bfe7a06f85069aabf8837"
x-amz-server-side-encryption: AES256
vary: Accept-Encoding
x-cache: Hit from cloudfront
content-type: text/javascript
cache-control: public, max-age=86400
x-amz-cf-id: WTvX5ttciShi2qtyvW6yDv8UqW1673zsmhn3yVgfvsyM_DUXPenXOw==

GET
H2 200 / Show response
t.dtscdn.com/widget/ 0
601 B 248ms
89ms Script
application/javascript 2606:4700:20::681a:d3c
CLOUDFLARENET

General

Check archive.org

Show headers Download Go to

Full URL: https://t.dtscdn.com/widget/?d=51A01711761383C3AD6250C483A92E62&nid=300&p=2114454483&t=600&s=800x600x24&u=https%3A%2F%2Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%2F&r=
Requested by: Host: e.dtscout.com
URL: https://e.dtscout.com/e/?v=1a&pid=5200&site=1&l=https%3A%2F%2Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%2F&j=
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2606:4700:20::681a:d3c , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software: cloudflare /
Resource Hash: e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:16:25 GMT
x-t: 1.28
content-encoding: br
cf-cache-status: DYNAMIC
nel: {"success_fraction":0,"report_to":"cf-nel","max_age":604800}
server: cloudflare
report-to: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report\/v4?s=aruNeEaxFSrxnnN4WX2Gf17LI6NZ88Q9wUScv4Bq4%2B%2FTtRH8kTIkUQC%2FKZrWzQx9QeWSJYcKpDbxZU0seL%2FnO6NaeJgm9%2B4zJEJdAh1YSX5Y0BXEl5Z0cUZCcPjHt73aJtx74eNAHfEIVw%3D%3D"}],"group":"cf-nel","max_age":604800}
content-type: application/javascript; charset=UTF-8
cache-control: no-cache
x-server: web15.ny1.dtscdn.com
cf-ray: 86c44110194c67da-MIA
expires: Sat, 30 Mar 2024 01:17:15 GMT

GET
H2

200

2981
tags.bluekai.com/site/
Redirect Chain

https://pixel.onaudience.com/?partner=137085098&mapped=51A01711761383C3AD6250C483A92E62
https://pixel.onaudience.com/?partner=109&icm&cver&gdpr=0&smartmap=1&redirect=tags.bluekai.com%2Fsite%2F33141%3F%26id%3D%25m
https://tags.bluekai.com/site/33141?&id=9898b2ce7b9d420c
https://cm.g.doubleclick.net/pixel?google_nid=bluekai&google_cm&google_sc&google_hm=YTMvNGVId005OU8xcTk1Wg%3D%3D
https://cm.g.doubleclick.net/pixel?google_nid=bluekai&google_cm=&google_sc=&google_hm=YTMvNGVId005OU8xcTk1Wg%3D%3D&google_tc=
https://tags.bluekai.com/site/2981?id=&google_gid=CAESEJ4NHEc76tDvdUY8H9Nhfbs&google_cver=1

62 B
341 B

142ms
141ms

Image
image/gif

23.37.233.35
AKAMAI-AS

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://tags.bluekai.com/site/2981?id=&google_gid=CAESEJ4NHEc76tDvdUY8H9Nhfbs&google_cver=1
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Server: 23.37.233.35 Edison, United States, ASN16625 (AKAMAI-AS, US),
Reverse DNS: a23-37-233-35.deploy.static.akamaitechnologies.com
Software: /
Resource Hash: 0af3aae90b7de9fdceee2ab421378ea2f54c74be81ef43fc6c1790a032755d80

Request headers

accept-language: en-US,en;q=0.9
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

p3p: CP="NOI DSP COR CUR ADMo DEVo PSAo PSDo OUR SAMo BUS UNI NAV", policyref="http://tags.bluekai.com/w3c/p3p.xml"
date: Sat, 30 Mar 2024 01:16:26 GMT
content-length: 62
x-request-id: ba0c4a7e84d50ec32042c54794ba0e8b
content-type: image/gif

Redirect headers

pragma: no-cache
date: Sat, 30 Mar 2024 01:16:26 GMT
server: HTTP server (unknown)
content-type: text/html; charset=UTF-8
location: https://tags.bluekai.com/site/2981?id=&google_gid=CAESEJ4NHEc76tDvdUY8H9Nhfbs&google_cver=1
p3p: policyref="https://googleads.g.doubleclick.net/pagead/gcn_p3p_.xml", CP="CURa ADMa DEVa TAIo PSAo PSDo OUR IND UNI PUR INT DEM STA PRE COM NAV OTC NOI DSP COR"
cache-control: no-cache, must-revalidate
cross-origin-resource-policy: cross-origin
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
content-length: 296
x-xss-protection: 0
expires: Fri, 01 Jan 1990 00:00:00 GMT

GET
H2

200

v2 Show response
ap.lijit.com/readerinfo/
Redirect Chain

https://ap.lijit.com/readerinfo/v2
https://ap.lijit.com/readerinfo/v2?sovrn_retry=true

41 B
354 B

59ms
59ms

Fetch
application/json

52.3.41.35
AMAZON-AES

General

Check archive.org

Show headers Download Go to

Full URL: https://ap.lijit.com/readerinfo/v2?sovrn_retry=true
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Server: 52.3.41.35 Ashburn, United States, ASN14618 (AMAZON-AES, US),
Reverse DNS: ec2-52-3-41-35.compute-1.amazonaws.com
Software: /
Resource Hash: e8d215c2b0559a3984a64151d0eba137246e8b009bf60d7f015cc9384e08eb3b

Request headers

accept-language: en-US,en;q=0.9
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

date: Sat, 30 Mar 2024 01:16:25 GMT
content-encoding: gzip
vary: Accept-Encoding, User-Agent
access-control-allow-methods: GET, POST, DELETE, PUT
content-type: application/json
access-control-allow-origin: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
access-control-allow-credentials: true
access-control-allow-headers: X-Requested-With, Content-Type
content-length: 61

Redirect headers

location: https://ap.lijit.com/readerinfo/v2?sovrn_retry=true
access-control-allow-origin: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
date: Sat, 30 Mar 2024 01:16:25 GMT
access-control-allow-credentials: true
access-control-allow-headers: X-Requested-With, Content-Type
content-length: 0
access-control-allow-methods: GET, POST, DELETE, PUT

GET
H2 200 1540_03681 Show response
track2.securedvisit.com/sync/ 43 B
178 B 903ms
68ms Script
image/gif 44.209.254.124
AMAZON-AES

General

Check archive.org

Show headers Download Go to

Full URL: https://track2.securedvisit.com/sync/1540_03681?id=IZ6MASZHEJmM2GwjRW6x-cEw
Requested by: Host: data-beacons.s-onetag.com
URL: https://data-beacons.s-onetag.com/dataBeacons.min.js
Protocol: H2
Security: TLS 1.2, ECDHE_RSA, AES_128_GCM
Server: 44.209.254.124 Ashburn, United States, ASN14618 (AMAZON-AES, US),
Reverse DNS: ec2-44-209-254-124.compute-1.amazonaws.com
Software: nginx/1.24.0 /
Resource Hash: f4eef8263281c0b26486637831251059757bc3fdc4c3a48045a8ef8646b36e8f

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

pragma: no-cache
date: Sat, 30 Mar 2024 01:16:26 GMT
cache-control: private, no-cache, proxy-revalidate
server: nginx/1.24.0
content-length: 43
content-type: image/gif

GET
H2 204 ProfilesEngineServlet
api.intentiq.com/profiles_engine/ Frame 1991 0
0 408ms
72ms Document
text/plain 13.226.34.99
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://api.intentiq.com/profiles_engine/ProfilesEngineServlet?at=15&eid=19&aw=468&ah=60&pagePos=1&vip=true&secure=1&sub_eid=15052&maxed=1&rnd=51051
Requested by: Host: data-beacons.s-onetag.com
URL: https://data-beacons.s-onetag.com/dataBeacons.min.js
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 13.226.34.99 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS: server-13-226-34-99.ewr53.r.cloudfront.net
Software: /
Resource Hash

Request headers

Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Upgrade-Insecure-Requests: 1
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
accept-language: en-US,en;q=0.9
sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-mobile: ?0
sec-ch-ua-platform: "Win32"

Response headers

alt-svc: h3=":443"; ma=86400
date: Sat, 30 Mar 2024 01:16:26 GMT
p3p: CP="NOI DSP COR NID CURa ADMo TAIa PSAo PSDo OUR SAMo BUS UNI PUR COM NAV INT DEM CNT STA PRE LOC"
via: 1.1 da79f1e019da644d2a3fd9e73f79a700.cloudfront.net (CloudFront)
x-amz-cf-id: t6ICNxkQ66XB4BdhWjZdxO-qe55CHceVjPmHddcT7AimhsolCeLc_Q==
x-amz-cf-pop: EWR53-C2
x-cache: Miss from cloudfront

GET
H2

200

sync
pippio.com/api/
Redirect Chain

https://i.liadm.com/s/76929?bidder_id=204553&bidder_uuid=IZ6MASZHEJmM2GwjRW6x-cEw&rnd=16377
https://i.liadm.com/s/76929?bidder_id=204553&bidder_uuid=IZ6MASZHEJmM2GwjRW6x-cEw&rnd=16377&_li_chk=true&previous_uuid=5ef81211c4b84025b6988d908aa1734d
https://live.rezync.com/sync?c=0aa2530f29e4f4a05b5d5d9bb35d60c2&p=93c1662463a616a7155169889dd99651&pid=5ef81211-c4b8-4025-b698-8d908aa1734d
https://p.rfihub.com/cm?pub=39342&in=1&userid=87e27168-f1d7-4beb-a884-8db65a6ff223%3A1711761387.9673643&forward=https%3A//i.liadm.com/s/56409%3Fbidder_id%3D200442%26bidder_uuid%3D87e27168-f1d7-4beb...
https://live.rezync.com/pixel?c=bd8618c307ae9885a12561b7191e2cea&cid=970033174938740873&referrer={encSite}&forward=https%3A%2F%2Fi.liadm.com%2Fs%2F56409%3Fbidder_id%3D200442%26bidder_uuid%3D87e2716...
https://i.liadm.com/s/56409?bidder_id=200442&bidder_uuid=87e27168-f1d7-4beb-a884-8db65a6ff223%3A1711761387.9673643&pid=500040&it=1&iv=87e27168-f1d7-4beb-a884-8db65a6ff223%3A1711761387.9673643&_=171...
https://pippio.com/api/sync?it=1&pid=500040&_=1711761387.969343&iv=87e27168-f1d7-4beb-a884-8db65a6ff223:1711761387.9673643

42 B
169 B

95ms
89ms

Image
image/gif

107.178.254.65
GOOGLE-CLOUD-PLAT...

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://pippio.com/api/sync?it=1&pid=500040&_=1711761387.969343&iv=87e27168-f1d7-4beb-a884-8db65a6ff223:1711761387.9673643
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Server: 107.178.254.65 Kansas City, United States, ASN396982 (GOOGLE-CLOUD-PLATFORM, US),
Reverse DNS: 65.254.178.107.bc.googleusercontent.com
Software: /
Resource Hash: ef1955ae757c8b966c83248350331bd3a30f658ced11f387f8ebf05ab3368629

Request headers

accept-language: en-US,en;q=0.9
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

date: Sat, 30 Mar 2024 01:16:28 GMT
via: 1.1 google
content-type: image/gif
p3p: CP="NOI DSP COR NID CURa ADMa DEVa PSAa PSDa OUR BUS COM INT OTC PUR STA"
cache-control: no-cache, no-store
timing-allow-origin: *
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
content-length: 42

Redirect headers

Location: https://pippio.com/api/sync?it=1&pid=500040&_=1711761387.969343&iv=87e27168-f1d7-4beb-a884-8db65a6ff223:1711761387.9673643
Date: Sat, 30 Mar 2024 01:16:28 GMT
Strict-Transport-Security: max-age=31536000; includeSubDomains
Connection: keep-alive
Content-Length: 0
Request-Time: 1

GET
H2

200

db_sync
px.ads.linkedin.com/
Redirect Chain

https://px.ads.linkedin.com/db_sync?pid=15697&puuid=IZ6MASZHEJmM2GwjRW6x-cEw&rand=88759&pu=
https://px.ads.linkedin.com/db_sync?pid=15697&puuid=IZ6MASZHEJmM2GwjRW6x-cEw&rand=88759&pu=&expected_cookie=545913c9-559e-43b6-a1b0-8c321336a7a5

0
142 B

151ms
75ms

Image
text/plain

2620:1ec:21::14
MICROSOFT-CORP-MS...

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://px.ads.linkedin.com/db_sync?pid=15697&puuid=IZ6MASZHEJmM2GwjRW6x-cEw&rand=88759&pu=&expected_cookie=545913c9-559e-43b6-a1b0-8c321336a7a5
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Server: 2620:1ec:21::14 , United States, ASN8068 (MICROSOFT-CORP-MSN-AS-BLOCK, US),
Reverse DNS
Software: /
Resource Hash: e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855

Request headers

accept-language: en-US,en;q=0.9
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

date: Sat, 30 Mar 2024 01:16:27 GMT
x-li-pop: afd-prod-lor1-x
x-msedge-ref: Ref A: 16A8A7936B734612917D8240BA85C02A Ref B: MIA301000108027 Ref C: 2024-03-30T01:16:27Z
linkedin-action: 1
x-cache: CONFIG_NOCACHE
x-li-fabric: prod-lor1
x-li-proto: http/2
content-length: 0
x-li-uuid: AAYU1oF0tzMppAknvuK9hA==

Redirect headers

date: Sat, 30 Mar 2024 01:16:26 GMT
x-li-pop: afd-prod-lor1-x
x-msedge-ref: Ref A: 379DA8BDADEE4E89BB1F0DE4C216080C Ref B: MIA301000108027 Ref C: 2024-03-30T01:16:27Z
linkedin-action: 1
x-cache: CONFIG_NOCACHE
x-li-fabric: prod-lor1
location: /db_sync?pid=15697&puuid=IZ6MASZHEJmM2GwjRW6x-cEw&rand=88759&pu=&expected_cookie=545913c9-559e-43b6-a1b0-8c321336a7a5
x-li-proto: http/2
content-length: 0
x-li-uuid: AAYU1oFyOQzugCDRA/daGw==

GET
H2

200

merge
ce.lijit.com/
Redirect Chain

https://um.simpli.fi/lj_match?r=58644
https://ce.lijit.com/merge?pid=2&3pid=49DBE3392DC240ABA420ABA7428B6F9E

43 B
494 B

270ms
53ms

Image
image/gif

3.235.217.129
AMAZON-AES

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://ce.lijit.com/merge?pid=2&3pid=49DBE3392DC240ABA420ABA7428B6F9E
Requested by: Host: jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Protocol: H2
Server: 3.235.217.129 Ashburn, United States, ASN14618 (AMAZON-AES, US),
Reverse DNS: ec2-3-235-217-129.compute-1.amazonaws.com
Software: /
Resource Hash: b1442e85b03bdcaf66dc58c7abb98745dd2687d86350be9a298a1d9382ac849b

Request headers

accept-language: en-US,en;q=0.9
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

p3p: CP="CUR ADM OUR NOR STA NID"
pragma: no-cache
date: Sat, 30 Mar 2024 01:16:28 GMT
cache-control: private, no-cache, no-store, must-revalidate, proxy-revalidate, max-age=0, s-maxage=0
expires: Fri, 20 Mar 2009 00:00:00 GMT
content-length: 43
content-type: image/gif

Redirect headers

date: Sat, 30 Mar 2024 01:16:27 GMT
strict-transport-security: max-age=63072000; includeSubdomains; preload
x-content-type-options: nosniff
server: openresty
access-control-allow-methods: GET, POST, OPTIONS
content-type: text/html
location: https://ce.lijit.com/merge?pid=2&3pid=49DBE3392DC240ABA420ABA7428B6F9E
access-control-allow-origin: *
cache-control: no-cache
access-control-allow-headers: DNT,X-Mx-ReqToken,Keep-Alive,User-Agent,X-Requested-With,If-Modified-Since,Cache-Control,Content-Type
content-length: 142
expires: Fri, 29 Mar 2024 01:16:27 GMT

GET
H2 200 Portal.html
get.s-onetag.com/underground-sync-portal/ Frame D18A 0
0 224ms
59ms Document
text/html 18.238.55.108
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://get.s-onetag.com/underground-sync-portal/Portal.html
Requested by: Host: get.s-onetag.com
URL: https://get.s-onetag.com/f0c84061-4182-4398-8e37-5ff5b5698a6f/tag.min.js
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 18.238.55.108 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS: server-18-238-55-108.jfk52.r.cloudfront.net
Software: AmazonS3 /
Resource Hash

Request headers

Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Upgrade-Insecure-Requests: 1
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
accept-language: en-US,en;q=0.9
sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-mobile: ?0
sec-ch-ua-platform: "Win32"

Response headers

accept-ranges: bytes
age: 757046
cache-control: max-age=864000
content-length: 85
content-type: text/html
date: Thu, 21 Mar 2024 06:59:03 GMT
etag: "131a68f1a3ad405d816af56e04b93481"
last-modified: Mon, 24 Aug 2020 10:07:31 GMT
server: AmazonS3
vary: Accept-Encoding
via: 1.1 46b3f244fe2a22dff3a717bf9da34d86.cloudfront.net (CloudFront)
x-amz-cf-id: PL73QhTO25UpQmGxOqG88XY5n8h5q4otAxTxQCgwYnQXJQjO2MfaAQ==
x-amz-cf-pop: JFK52-P4
x-amz-version-id: DQOg1_kyPY_kvsj6PY1Vb4lkt_z.UEMu
x-cache: Hit from cloudfront

GET
H2 200 optimus_rules.json Show response
tags.crwdcntrl.net/lt/c/3825/ 4 KB
1 KB 579ms
176ms XHR
application/json 108.138.128.34
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://tags.crwdcntrl.net/lt/c/3825/optimus_rules.json
Requested by: Host: tags.crwdcntrl.net
URL: https://tags.crwdcntrl.net/lt/c/3825/lt.min.js
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 108.138.128.34 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS: server-108-138-128-34.jfk50.r.cloudfront.net
Software: AmazonS3 /
Resource Hash: 08b479c3eeb1cb4d44354e6bf17322cd7acd38ae9a33ee5956898447ed43fab6

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-platform: "Win32"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
Content-Type: text/plain;charset=UTF-8

Response headers

date: Sat, 30 Mar 2024 01:16:30 GMT
content-encoding: gzip
via: 1.1 b4bbc10bb9b68293dc88560c2ddfcc2c.cloudfront.net (CloudFront)
last-modified: Wed, 14 Feb 2024 15:50:54 GMT
server: AmazonS3
x-amz-cf-pop: JFK50-P4
etag: W/"f16e89fd08a708a6bd2e69be50fd30ab"
x-amz-server-side-encryption: AES256
vary: Accept-Encoding,Origin,Access-Control-Request-Headers,Access-Control-Request-Method
access-control-allow-methods: GET
content-type: application/json
access-control-allow-origin: *
x-cache: Miss from cloudfront
cache-control: public, max-age=86400
x-amz-cf-id: s3tQxSZGEPk8e1IpTLmhz-9p-Me8WjZvf5bG8PSoJuSpVb8DRP9RYg==

GET
H3 200 favicon.png
jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/images/ 6 KB
6 KB 100ms
100ms Other
image/png 216.219.95.231
IS-AS-1

General

Check archive.org

Show headers Download Go to

Full URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/images/favicon.png
Protocol: H3
Security: QUIC, , AES_128_GCM
Server: 216.219.95.231 , United States, ASN19318 (IS-AS-1, US),
Reverse DNS: vps.viewliveevents.in
Software: LiteSpeed /
Resource Hash: 0913abf402e9b4288b864d7e28eb708cfa516900d6f6bf356b5688978b9b8e65

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:16:28 GMT
last-modified: Sat, 09 Sep 2023 12:56:42 GMT
server: LiteSpeed
etag: "1725-64fc6b8a-164385b1;;;"
content-type: image/png
cache-control: public, max-age=604800
accept-ranges: bytes
alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"
content-length: 5925
expires: Sat, 06 Apr 2024 01:16:28 GMT

GET
H2

200

merge
ce.lijit.com/
Redirect Chain

https://bcp.crwdcntrl.net/5/c=5436/tp=SVRN/tpid=IZ6MASZHEJmM2GwjRW6x-cEw/pv=y?https://ce.lijit.com/merge?pid=5001&3pid=${profile_id}
https://ce.lijit.com/merge?pid=5001&3pid=e892471a0e85b5173c586ecb825ddae7

43 B
731 B

61ms
59ms

Image
image/gif

3.235.217.129
AMAZON-AES

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://ce.lijit.com/merge?pid=5001&3pid=e892471a0e85b5173c586ecb825ddae7
Protocol: H2
Server: 3.235.217.129 Ashburn, United States, ASN14618 (AMAZON-AES, US),
Reverse DNS: ec2-3-235-217-129.compute-1.amazonaws.com
Software: /
Resource Hash: b1442e85b03bdcaf66dc58c7abb98745dd2687d86350be9a298a1d9382ac849b

Request headers

accept-language: en-US,en;q=0.9
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

p3p: CP="CUR ADM OUR NOR STA NID"
pragma: no-cache
date: Sat, 30 Mar 2024 01:16:28 GMT
cache-control: private, no-cache, no-store, must-revalidate, proxy-revalidate, max-age=0, s-maxage=0
expires: Fri, 20 Mar 2009 00:00:00 GMT
content-length: 43
content-type: image/gif

Redirect headers

pragma: no-cache
date: Sat, 30 Mar 2024 01:16:28 GMT
server: Jetty(9.4.38.v20210224)
p3p: CP=NOI DSP COR NID PSAa PSDa OUR UNI COM NAV
location: https://ce.lijit.com/merge?pid=5001&3pid=e892471a0e85b5173c586ecb825ddae7
cache-control: no-cache
x-server: 10.40.62.179
content-length: 0
expires: 0

GET
H/1.1 200
OK pixel Show response
ps.eyeota.net/ 761 B
1 KB 256ms
70ms Script
application/javascript 50.16.174.192
AMAZON-AES

General

Check archive.org

Show headers Download Go to

Full URL: https://ps.eyeota.net/pixel?pid=51md42u&t=ajs&e_pc=3&e_mr=0
Requested by: Host: data-beacons.s-onetag.com
URL: https://data-beacons.s-onetag.com/dataBeacons.min.js
Protocol: HTTP/1.1
Security: TLS 1.2, ECDHE_RSA, AES_256_GCM
Server: 50.16.174.192 Ashburn, United States, ASN14618 (AMAZON-AES, US),
Reverse DNS: ec2-50-16-174-192.compute-1.amazonaws.com
Software: /
Resource Hash: 3579fdf608da8b94dcde86b2bd83e6e14c563bb4a5496460b6ebdd4004d31ed4

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

Content-Type: application/javascript
Date: Sat, 30 Mar 2024 01:16:29 GMT
Content-Length: 761
P3P: CP="CURa ADMa DEVa TAIo PSAo PSDo OUR SAMo BUS UNI PUR INT DEM STA PRE COM NAV OTC NOI DSP COR", policyref="http://ps.eyeota.net/w3c/p3p.xml"

POST
H2 200 data Show response
bcp.crwdcntrl.net/6/ 317 B
1 KB 86ms
86ms XHR
application/json 54.234.166.1
AMAZON-AES

General

Check archive.org

Show headers Download Go to

Full URL: https://bcp.crwdcntrl.net/6/data
Requested by: Host: tags.crwdcntrl.net
URL: https://tags.crwdcntrl.net/lt/c/3825/lt.min.js
Protocol: H2
Security: TLS 1.2, ECDHE_RSA, AES_128_GCM
Server: 54.234.166.1 Ashburn, United States, ASN14618 (AMAZON-AES, US),
Reverse DNS: ec2-54-234-166-1.compute-1.amazonaws.com
Software: Jetty(9.4.38.v20210224) /
Resource Hash: a9bb002b8d8261043b0157782d68e8d159482baf7eb3c20ddef606b1e6af2bb0

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-platform: "Win32"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
Content-Type: text/plain;charset=UTF-8

Response headers

pragma: no-cache
date: Sat, 30 Mar 2024 01:16:29 GMT
server: Jetty(9.4.38.v20210224)
content-type: application/json;charset=utf-8
p3p: CP=NOI DSP COR NID PSAa PSDa OUR UNI COM NAV
access-control-allow-origin: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
cache-control: no-cache
x-server: 10.40.1.12
access-control-allow-credentials: true
content-length: 317
expires: 0

POST
H3 200 a
a.dtssrv.com/ 0
440 B 505ms
95ms Ping
text/html 172.67.163.146
CLOUDFLARENET

General

Check archive.org

Show headers Download Go to

Full URL: https://a.dtssrv.com/a?i=51A01711761383C3AD6250C483A92E62&k=lotpano&v=cc0d2c11d94b66737f9d15da2c91a9fb927a63435c67cacc34f401bbef2e2cfb
Requested by: Host: e.dtscout.com
URL: https://e.dtscout.com/e/?v=1a&pid=5200&site=1&l=https%3A%2F%2Fjahnaviwithsaathwiksamala.appvideo.fcliveevents.in%2F&j=
Protocol: H3
Security: QUIC, , AES_128_GCM
Server: 172.67.163.146 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software: cloudflare /
Resource Hash: e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Sat, 30 Mar 2024 01:16:29 GMT
content-encoding: br
cf-cache-status: DYNAMIC
nel: {"success_fraction":0,"report_to":"cf-nel","max_age":604800}
server: cloudflare
report-to: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report\/v4?s=hDg666EHaNRU%2BLrpkItFz94Q1%2FXPjK%2BY3Ch%2FJngVG2GPYpDmuHdnavnjW8ldaad91FVZtn%2BDTFzOKiKyV1EuQoT2RSnsv63EWtwfL26pjMskQzVqVwRk3FLBP61SmKU%3D"}],"group":"cf-nel","max_age":604800}
content-type: text/html; charset=UTF-8
cf-ray: 86c4412e480a74b4-MIA
alt-svc: h3=":443"; ma=86400

GET
H2 200 lt.iframe.html
tags.crwdcntrl.net/lt/shared/2/ Frame FEF0 0
0 82ms
75ms Document
text/html 108.138.128.28
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://tags.crwdcntrl.net/lt/shared/2/lt.iframe.html?c=3825
Requested by: Host: tags.crwdcntrl.net
URL: https://tags.crwdcntrl.net/lt/c/3825/lt.min.js
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 108.138.128.28 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS: server-108-138-128-28.jfk50.r.cloudfront.net
Software: AmazonS3 /
Resource Hash

Request headers

Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Upgrade-Insecure-Requests: 1
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
accept-language: en-US,en;q=0.9
sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-mobile: ?0
sec-ch-ua-platform: "Win32"

Response headers

age: 4833
cache-control: public, max-age=86400
content-encoding: gzip
content-type: text/html
date: Fri, 29 Mar 2024 23:55:57 GMT
etag: W/"43b17c7b81b6281ca01991a2e5cae3a7"
last-modified: Tue, 05 Sep 2023 17:36:56 GMT
server: AmazonS3
vary: Accept-Encoding
via: 1.1 2041b05ebafba84de0e785871a4269bc.cloudfront.net (CloudFront)
x-amz-cf-id: BPGOS7jlk4IUg8C3ozBZCCe9NDBDxqC5LsbSh3LXKMk09jW9P1AUzQ==
x-amz-cf-pop: JFK50-P4
x-amz-server-side-encryption: AES256
x-cache: Hit from cloudfront

GET
H/1.1

200
OK

match
ps.eyeota.net/
Redirect Chain

https://match.adsrvr.org/track/cmf/generic?ttd_pid=eyeota&ttd_tpi=1&gdpr=0&gdpr_consent=
https://ps.eyeota.net/match?uid=cba85754-2b38-48f3-8e98-6a1492b11d52&bid=1e2n4ou

70 B
440 B

93ms
82ms

Image
image/gif

50.16.174.192
AMAZON-AES

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://ps.eyeota.net/match?uid=cba85754-2b38-48f3-8e98-6a1492b11d52&bid=1e2n4ou
Protocol: HTTP/1.1
Server: 50.16.174.192 Ashburn, United States, ASN14618 (AMAZON-AES, US),
Reverse DNS: ec2-50-16-174-192.compute-1.amazonaws.com
Software: /
Resource Hash: de9d3fd0eb948bd294477d0eda60a73b85caff1794803530d0463193a113da98

Request headers

accept-language: en-US,en;q=0.9
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

Content-Type: image/gif
Date: Sat, 30 Mar 2024 01:16:29 GMT
Content-Length: 70
P3P: CP="CURa ADMa DEVa TAIo PSAo PSDo OUR SAMo BUS UNI PUR INT DEM STA PRE COM NAV OTC NOI DSP COR", policyref="http://ps.eyeota.net/w3c/p3p.xml"

Redirect headers

location: https://ps.eyeota.net/match?uid=cba85754-2b38-48f3-8e98-6a1492b11d52&bid=1e2n4ou
date: Sat, 30 Mar 2024 01:16:29 GMT
server: Kestrel
content-length: 191

GET
H/1.1

200
OK

match
ps.eyeota.net/
Redirect Chain

https://cm.g.doubleclick.net/pixel?google_nid=eye&google_cm&google_sc&google_hm=MnlpazRaSGl3clU5TGxSUGNXamFJVlJuVUEtcmxUTHVjNTFveE92aGV4SzA&gdpr=0&gdpr_consent=&uid=1&bid=gdo9o51&newuser=1&referrer...
https://ps.eyeota.net/match?gdpr=0&gdpr_consent=&uid=1&bid=gdo9o51&newuser=1&referrer_pid=51md42u&google_gid=CAESEDNqN2u03NnXkd5tooDyot8&google_cver=1

70 B
440 B

77ms
70ms

Image
image/gif

50.16.174.192
AMAZON-AES

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://ps.eyeota.net/match?gdpr=0&gdpr_consent=&uid=1&bid=gdo9o51&newuser=1&referrer_pid=51md42u&google_gid=CAESEDNqN2u03NnXkd5tooDyot8&google_cver=1
Protocol: HTTP/1.1
Server: 50.16.174.192 Ashburn, United States, ASN14618 (AMAZON-AES, US),
Reverse DNS: ec2-50-16-174-192.compute-1.amazonaws.com
Software: /
Resource Hash: de9d3fd0eb948bd294477d0eda60a73b85caff1794803530d0463193a113da98

Request headers

accept-language: en-US,en;q=0.9
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

Content-Type: image/gif
Date: Sat, 30 Mar 2024 01:16:29 GMT
Content-Length: 70
P3P: CP="CURa ADMa DEVa TAIo PSAo PSDo OUR SAMo BUS UNI PUR INT DEM STA PRE COM NAV OTC NOI DSP COR", policyref="http://ps.eyeota.net/w3c/p3p.xml"

Redirect headers

pragma: no-cache
date: Sat, 30 Mar 2024 01:16:29 GMT
server: HTTP server (unknown)
content-type: text/html; charset=UTF-8
location: https://ps.eyeota.net/match?gdpr=0&gdpr_consent=&uid=1&bid=gdo9o51&newuser=1&referrer_pid=51md42u&google_gid=CAESEDNqN2u03NnXkd5tooDyot8&google_cver=1
p3p: policyref="https://googleads.g.doubleclick.net/pagead/gcn_p3p_.xml", CP="CURa ADMa DEVa TAIo PSAo PSDo OUR IND UNI PUR INT DEM STA PRE COM NAV OTC NOI DSP COR"
cache-control: no-cache, must-revalidate
cross-origin-resource-policy: cross-origin
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
content-length: 375
x-xss-protection: 0
expires: Fri, 01 Jan 1990 00:00:00 GMT

GET
H/1.1

200
OK

match
ps.eyeota.net/
Redirect Chain

https://cms.analytics.yahoo.com/cms?partner_id=Eyeot
https://ups.analytics.yahoo.com/ups/58773/cms?partner_id=Eyeot
https://ps.eyeota.net/match?bid=bhc9gd0&yahoo_ver=2&yahoo_id=y-DuIKkhpE2pWHOtT0q86vMzh7Bs3abFACTjs-~A

70 B
440 B

77ms
76ms

Image
image/gif

50.16.174.192
AMAZON-AES

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://ps.eyeota.net/match?bid=bhc9gd0&yahoo_ver=2&yahoo_id=y-DuIKkhpE2pWHOtT0q86vMzh7Bs3abFACTjs-~A
Protocol: HTTP/1.1
Server: 50.16.174.192 Ashburn, United States, ASN14618 (AMAZON-AES, US),
Reverse DNS: ec2-50-16-174-192.compute-1.amazonaws.com
Software: /
Resource Hash: de9d3fd0eb948bd294477d0eda60a73b85caff1794803530d0463193a113da98

Request headers

accept-language: en-US,en;q=0.9
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

Content-Type: image/gif
Date: Sat, 30 Mar 2024 01:16:30 GMT
Content-Length: 70
P3P: CP="CURa ADMa DEVa TAIo PSAo PSDo OUR SAMo BUS UNI PUR INT DEM STA PRE COM NAV OTC NOI DSP COR", policyref="http://ps.eyeota.net/w3c/p3p.xml"

Redirect headers

location: https://ps.eyeota.net/match?bid=bhc9gd0&yahoo_ver=2&yahoo_id=y-DuIKkhpE2pWHOtT0q86vMzh7Bs3abFACTjs-~A
date: Sat, 30 Mar 2024 01:16:29 GMT
strict-transport-security: max-age=31536000
server: ATS/9.1.10.106
age: 0
content-length: 0
p3p: CP=NOI DSP COR LAW CURa DEVa TAIa PSAa PSDa OUR BUS UNI COM NAV

GET
H/1.1

200
OK

match
ps.eyeota.net/
Redirect Chain

https://sync-tm.everesttech.net/upi/pid/lons7jax?redir=https%3A%2F%2Fps.eyeota.net%2Fmatch%3Fuid%3D%24%7BTM_USER_ID%7D%26bid%3D0rijhbu%26referrer_pid%3D51md42u
https://sync-tm.everesttech.net/ct/upi/pid/lons7jax?redir=https%3A%2F%2Fps.eyeota.net%2Fmatch%3Fuid%3D%24%7BTM_USER_ID%7D%26bid%3D0rijhbu%26referrer_pid%3D51md42u&_test=Zgdn7QACPAzVcgBi
https://ps.eyeota.net/match?uid=Zgdn7QACPAzVcgBi&bid=0rijhbu&referrer_pid=51md42u&_test=Zgdn7QACPAzVcgBi

70 B
440 B

69ms
68ms

Image
image/gif

50.16.174.192
AMAZON-AES

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://ps.eyeota.net/match?uid=Zgdn7QACPAzVcgBi&bid=0rijhbu&referrer_pid=51md42u&_test=Zgdn7QACPAzVcgBi
Protocol: HTTP/1.1
Server: 50.16.174.192 Ashburn, United States, ASN14618 (AMAZON-AES, US),
Reverse DNS: ec2-50-16-174-192.compute-1.amazonaws.com
Software: /
Resource Hash: de9d3fd0eb948bd294477d0eda60a73b85caff1794803530d0463193a113da98

Request headers

accept-language: en-US,en;q=0.9
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

Content-Type: image/gif
Date: Sat, 30 Mar 2024 01:16:29 GMT
Content-Length: 70
P3P: CP="CURa ADMa DEVa TAIo PSAo PSDo OUR SAMo BUS UNI PUR INT DEM STA PRE COM NAV OTC NOI DSP COR", policyref="http://ps.eyeota.net/w3c/p3p.xml"

Redirect headers

x-served-by: cache-mia-kmia1760069-MIA
pragma: no-cache
date: Sat, 30 Mar 2024 01:16:29 GMT
via: 1.1 varnish
server: Varnish
x-timer: S1711761390.882656,VS0,VE0
x-cache: HIT
location: https://ps.eyeota.net/match?uid=Zgdn7QACPAzVcgBi&bid=0rijhbu&referrer_pid=51md42u&_test=Zgdn7QACPAzVcgBi
cache-control: no-cache
accept-ranges: bytes
content-length: 0
retry-after: 0
x-cache-hits: 0

GET
H/1.1

200
OK

match
ps.eyeota.net/
Redirect Chain

https://ib.adnxs.com/getuid?https%3A%2F%2Fps.eyeota.net%2Fmatch%3Fuid%3D%24UID%26bid%3D2cr76e1%26referrer_pid%3D51md42u
https://ib.adnxs.com/bounce?%2Fgetuid%3Fhttps%253A%252F%252Fps.eyeota.net%252Fmatch%253Fuid%253D%2524UID%2526bid%253D2cr76e1%2526referrer_pid%253D51md42u
https://ps.eyeota.net/match?uid=5134189823149296003&bid=2cr76e1&referrer_pid=51md42u

70 B
440 B

63ms
63ms

Image
image/gif

50.16.174.192
AMAZON-AES

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://ps.eyeota.net/match?uid=5134189823149296003&bid=2cr76e1&referrer_pid=51md42u
Protocol: HTTP/1.1
Server: 50.16.174.192 Ashburn, United States, ASN14618 (AMAZON-AES, US),
Reverse DNS: ec2-50-16-174-192.compute-1.amazonaws.com
Software: /
Resource Hash: de9d3fd0eb948bd294477d0eda60a73b85caff1794803530d0463193a113da98

Request headers

accept-language: en-US,en;q=0.9
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

Content-Type: image/gif
Date: Sat, 30 Mar 2024 01:16:30 GMT
Content-Length: 70
P3P: CP="CURa ADMa DEVa TAIo PSAo PSDo OUR SAMo BUS UNI PUR INT DEM STA PRE COM NAV OTC NOI DSP COR", policyref="http://ps.eyeota.net/w3c/p3p.xml"

Redirect headers

pragma: no-cache
date: Sat, 30 Mar 2024 01:16:30 GMT
an-x-request-uuid: 7f355b85-5951-437d-8fb7-b9ef1bc2bbc9
server: nginx/1.23.4
accept-ch: Sec-CH-UA-Full-Version-List,Sec-CH-UA-Arch,Sec-CH-UA-Model,Sec-CH-UA-Platform-Version,Sec-CH-UA-Bitness
p3p: policyref="http://cdn.adnxs-simple.com/w3c/policy/p3p.xml", CP="NOI DSP COR ADM PSAo PSDo OURo SAMo UNRo OTRo BUS COM NAV DEM STA PRE"
content-type: text/html; charset=utf-8
access-control-allow-origin: *
cache-control: no-store, no-cache, private
access-control-allow-credentials: true
location: https://ps.eyeota.net/match?uid=5134189823149296003&bid=2cr76e1&referrer_pid=51md42u
x-proxy-origin: 38.132.118.72; 38.132.118.72; 675.bm-nginx-loadbalancer.mgmt.nym2.adnexus.net; adnxs.com
content-length: 0
x-xss-protection: 0
expires: Sat, 15 Nov 2008 16:00:00 GMT

GET
H2

204

sync
thrtle.com/
Redirect Chain

https://thrtle.com/sync?vxii_pid=7002&vxii_pdid=IZ6MASZHEJmM2GwjRW6x-cEw
https://thrtle.com/sync?_reach=1&vxii_pdid=IZ6MASZHEJmM2GwjRW6x-cEw&vxii_pid=12&vxii_pid1=7002&vxii_rcid=33d58b9a-4412-499c-94eb-8ee8453ba781&vxii_rmax=1
https://a.tribalfusion.com/i.match?p=b31&redirect=https%3A%2F%2Fthrtle.com%2Fsync%3Fvxii_pid%3D5042%26vxii_pdid%3D%24TF_USER_ID_ENC%24%26vxii_ts%3D1%26_t%3D1711761390%26_reach%3D1&u=33d58b9a-4412-4...
https://s.tribalfusion.com/z/i.match?p=b31&redirect=https%3A%2F%2Fthrtle.com%2Fsync%3Fvxii_pid%3D5042%26vxii_pdid%3D%24TF_USER_ID_ENC%24%26vxii_ts%3D1%26_t%3D1711761390%26_reach%3D1&u=33d58b9a-4412...
https://thrtle.com/sync?vxii_pid=5042&vxii_pdid=18072662076936486681&vxii_ts=1&_t=1711761390&_reach=1

0
465 B

93ms
74ms

Image
text/plain

52.203.90.63
AMAZON-AES

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://thrtle.com/sync?vxii_pid=5042&vxii_pdid=18072662076936486681&vxii_ts=1&_t=1711761390&_reach=1
Protocol: H2
Server: 52.203.90.63 Ashburn, United States, ASN14618 (AMAZON-AES, US),
Reverse DNS: ec2-52-203-90-63.compute-1.amazonaws.com
Software: /
Resource Hash: e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855

Request headers

accept-language: en-US,en;q=0.9
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

date: Sat, 30 Mar 2024 01:16:30 GMT
p3p: CP="NOI OUR BUS UNI COM NAV"

Redirect headers

pragma: no-cache
date: Sat, 30 Mar 2024 01:16:30 GMT
cf-cache-status: DYNAMIC
x-function: 209
server: cloudflare
x-reuse-index: 558
content-type: text/html
location: https://thrtle.com/sync?vxii_pid=5042&vxii_pdid=18072662076936486681&vxii_ts=1&_t=1711761390&_reach=1
p3p: CP="NOI DEVo TAIa OUR BUS"
cache-control: no-cache, private
cf-ray: 86c441344fe7097d-MIA
alt-svc: h3=":443"; ma=86400
expires: Thu, 01 Jan 1970 00:00:00 GMT

GET
H2

200

sovrn_standalone_beacon.js Show response
cdn.lijit.com/www/sovrn_beacon_standalone/
Redirect Chain

https://ap.lijit.com/www/sovrn_beacon_standalone/sovrn_standalone_beacon.js
https://cdn.lijit.com/www/sovrn_beacon_standalone/sovrn_standalone_beacon.js

21 KB
21 KB

241ms
70ms

Script
text/javascript

108.139.47.115
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://cdn.lijit.com/www/sovrn_beacon_standalone/sovrn_standalone_beacon.js
Protocol: H2
Server: 108.139.47.115 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS: server-108-139-47-115.jfk50.r.cloudfront.net
Software: AmazonS3 /
Resource Hash: 0b06ca55c1eb4674bf666bee6cd0193d8e72d3ed8535b7b5df6160e0391d84fc

Request headers

accept-language: en-US,en;q=0.9
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

date: Sat, 30 Mar 2024 00:31:46 GMT
via: 1.1 8770cedbbb1c2feb157dc67ce83fe00c.cloudfront.net (CloudFront)
last-modified: Tue, 16 Jan 2024 17:32:11 GMT
server: AmazonS3
x-amz-cf-pop: JFK50-P1
age: 2685
x-amz-server-side-encryption: AES256
etag: "b4ecf05fe49c7d270978fd43997bee50"
x-cache: Hit from cloudfront
content-type: text/javascript
accept-ranges: bytes
content-length: 21172
x-amz-cf-id: Lgie3ezznhoD_ICncBMX3Ql4AePWNXuBc6YJMEdFUIOu_jU8HDtDyQ==

Redirect headers

location: https://cdn.lijit.com:443/www/sovrn_beacon_standalone/sovrn_standalone_beacon.js
date: Sat, 30 Mar 2024 01:16:30 GMT
server: awselb/2.0
content-length: 110
content-type: text/html

GET
H2 200 beacon
ce.lijit.com/ Frame 51EC 0
0 206ms
67ms Document
text/html 44.210.227.34
AMAZON-AES

General

Check archive.org

Show headers Download Go to

Full URL: https://ce.lijit.com/beacon?informer=&gdpr_consent=&us_privacy=&gpp=&gpp_sid=
Requested by: Host: ap.lijit.com
URL: https://ap.lijit.com/www/sovrn_beacon_standalone/sovrn_standalone_beacon.js
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 44.210.227.34 Ashburn, United States, ASN14618 (AMAZON-AES, US),
Reverse DNS: ec2-44-210-227-34.compute-1.amazonaws.com
Software: /
Resource Hash

Request headers

Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
Upgrade-Insecure-Requests: 1
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
accept-language: en-US,en;q=0.9
sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-mobile: ?0
sec-ch-ua-platform: "Win32"

Response headers

cache-control: private, no-cache, no-store, must-revalidate, proxy-revalidate, max-age=0, s-maxage=0
content-encoding: gzip
content-length: 1035
content-type: text/html
date: Sat, 30 Mar 2024 01:16:30 GMT
expires: Fri, 20 Mar 2009 00:00:00 GMT
p3p: CP="CUR ADM OUR NOR STA NID"
pragma: no-cache
vary: Accept-Encoding, User-Agent

GET
H2

200

merge
ce.lijit.com/
Redirect Chain

https://idpix.media6degrees.com/orbserv/hbpix?pixId=853949&pcv=129&ptid=39&tpuv=01&tpu=IZ6MASZHEJmM2GwjRW6x-cEw
https://ce.lijit.com/merge?pid=5&3pid=0g9uhs8b1v4u5&us_privacy=$(US_PRIVACY)

43 B
1 KB

125ms
71ms

Image
image/gif

3.235.217.129
AMAZON-AES

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://ce.lijit.com/merge?pid=5&3pid=0g9uhs8b1v4u5&us_privacy=$(US_PRIVACY)
Protocol: H2
Server: 3.235.217.129 Ashburn, United States, ASN14618 (AMAZON-AES, US),
Reverse DNS: ec2-3-235-217-129.compute-1.amazonaws.com
Software: /
Resource Hash: b1442e85b03bdcaf66dc58c7abb98745dd2687d86350be9a298a1d9382ac849b

Request headers

accept-language: en-US,en;q=0.9
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

p3p: CP="CUR ADM OUR NOR STA NID"
pragma: no-cache
date: Sat, 30 Mar 2024 01:16:32 GMT
cache-control: private, no-cache, no-store, must-revalidate, proxy-revalidate, max-age=0, s-maxage=0
expires: Fri, 20 Mar 2009 00:00:00 GMT
content-length: 43
content-type: image/gif

Redirect headers

pragma: no-cache
date: Sat, 30 Mar 2024 01:16:32 GMT
cf-cache-status: DYNAMIC
server: cloudflare
p3p: CP="COM NAV INT STA NID OUR IND NOI"
location: https://ce.lijit.com/merge?pid=5&3pid=0g9uhs8b1v4u5&us_privacy=$(US_PRIVACY)
cache-control: no-cache
cf-ray: 86c4413dcd48b3c5-MIA
content-length: 0

POST
H2 200 metrics
connect-metrics-collector.s-onetag.com/ 0
73 B 212ms
68ms Ping
text/plain 75.2.13.80
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://connect-metrics-collector.s-onetag.com/metrics
Requested by: Host: get.s-onetag.com
URL: https://get.s-onetag.com/f0c84061-4182-4398-8e37-5ff5b5698a6f/tag.min.js
Protocol: H2
Security: TLS 1.2, ECDHE_RSA, AES_128_GCM
Server: 75.2.13.80 , United States, ASN16509 (AMAZON-02, US),
Reverse DNS: a0cb5afe0ce76779e.awsglobalaccelerator.com
Software: /
Resource Hash: e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-platform: "Win32"
Referer: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
Content-Type: text/plain;charset=UTF-8

Response headers

access-control-allow-origin: *
date: Sat, 30 Mar 2024 01:16:35 GMT
content-length: 0
vary: Origin

Verdicts & Comments Add Verdict or Comment

244 JavaScript Global Variables

These are the non-standard "global" variables defined on the window object. These can be helpful in identifying possible client-side frameworks and code.

203 Cookies

Cookies are little pieces of information stored in the browser of a user. Whenever a user visits the site again, he will also send his cookie values, thus allowing the website to re-identify him even if he changed locations. This is how permanent logins work.

Domain/Path	Expires	Name / Value
i.liadm.com/s	1970-01-20 20:12:33	Name: _li_ss Value: CggKBgiiARDIFw
jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/	1970-01-21 04:14:57	Name: HstCfa3793781 Value: 1711761382058
jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/	1970-01-21 04:14:57	Name: HstCla3793781 Value: 1711761382058
jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/	1970-01-21 04:14:57	Name: HstCmu3793781 Value: 1711761382058
jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/	1970-01-21 04:14:57	Name: HstPn3793781 Value: 1
jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/	1970-01-21 04:14:57	Name: HstPt3793781 Value: 1
jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/	1970-01-21 04:14:57	Name: HstCnv3793781 Value: 1
jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/	1970-01-21 04:14:57	Name: HstCns3793781 Value: 1
.fcliveevents.in/	1970-01-21 05:05:21	Name: _ga_8GWGMS9S2Q Value: GS1.1.1711761382.1.0.1711761382.60.0.0
.fcliveevents.in/	1970-01-21 05:05:21	Name: _ga Value: GA1.2.2049877075.1711761382
.fcliveevents.in/	1970-01-20 19:30:47	Name: _gid Value: GA1.2.1551660678.1711761383
.fcliveevents.in/	1970-01-20 19:29:21	Name: _gat_gtag_UA_25105023_19 Value: 1
.dtscout.com/	1970-01-20 19:29:26	Name: m Value: 1
.dtscout.com/	1970-01-20 19:29:24	Name: st Value: 1
.dtscout.com/	1970-01-20 19:29:35	Name: oa Value: 1
.dtscout.com/	1970-01-20 21:53:21	Name: df Value: 1711761383
.dtscout.com/	1970-01-20 21:37:30	Name: l Value: 51A01711761383C3AD6250C483A92E62
.sharethis.com/	1970-01-21 04:14:57	Name: __stid Value: ZGUAAmYHZ+gAAAAIA4SEAw==
.sharethis.com/	1970-01-21 04:14:57	Name: __stidv Value: 2
.tynt.com/	1970-01-21 04:14:57	Name: uid Value: OTTukGYHZ+jEI2PjBBUHXQ==
.tynt.com/	1970-01-20 21:38:57	Name: pids Value: %5B%7B%22p%22%3A%220c1ae001bf%22%2C%22f%22%3A2%2C%22ts%22%3A1711761384492%7D%2C%7B%22p%22%3A%224bbb341d17%22%2C%22f%22%3A1%2C%22ts%22%3A1711761384492%7D%2C%7B%22p%22%3A%22b1b5df9b98%22%2C%22f%22%3A1%2C%22ts%22%3A1711761384492%7D%2C%7B%22p%22%3A%22e9b03986ff%22%2C%22f%22%3A2%2C%22ts%22%3A1711761384492%7D%5D
.fcliveevents.in/	1970-01-20 21:34:38	Name: __dtsu Value: 51A01711761383C3AD6250C483A92E62
.simpli.fi/	1970-01-21 04:16:23	Name: suid Value: 49DBE3392DC240ABA420ABA7428B6F9E
.33across.com/	1970-01-21 04:14:57	Name: 33x_b Value: 1
.t.sharethis.com/	1970-01-20 19:49:30	Name: pxcelPage_default_c010_C Value: 1_0_1711761384956
.dtscdn.com/	1970-01-20 23:47:06	Name: uid Value: 51A01711761383C3AD6250C483A92E62
.pippio.com/	1970-01-21 04:14:57	Name: did Value: AeaDx88M-g3GBO25
.pippio.com/	1970-01-21 04:14:57	Name: didts Value: 1711761385
.pippio.com/	1970-01-20 20:55:45	Name: nnls Value:
.pippio.com/	1970-01-20 20:55:45	Name: pxrc Value: CAA=
.lijit.com/	1970-01-21 04:14:57	Name: ljt_reader Value: IZ6MASZHEJmM2GwjRW6x-cEw
.rlcdn.com/	1970-01-21 04:14:57	Name: rlas3 Value: Ko7lI8AqbyQXZQj/e7jiwWsx6pYbmukvOkuJqnYfV4E=
.adsrvr.org/	1970-01-21 04:14:57	Name: TDID Value: cba85754-2b38-48f3-8e98-6a1492b11d52
.ml314.com/	1970-01-21 04:14:57	Name: pi Value: 3643097288522334219
.rlcdn.com/	1970-01-20 20:55:45	Name: pxrc Value: COjPnbAGEgUI6EcQABIFCNtOEAESBgi46wEQAQ==
.eyeota.net/	1970-01-21 04:14:57	Name: mako_uid Value: 18e8cede82b-2ad90000010a4ca0
.eyeota.net/	1970-01-20 19:29:21	Name: SERVERID Value: 19616~DM
.openx.net/	1970-01-21 04:14:57	Name: i Value: 49c09525-3102-46c2-917d-5ce3d8e45b7a\|1711761385
.crwdcntrl.net/	1970-01-21 01:58:09	Name: _cc_dc Value: 0
.crwdcntrl.net/	1970-01-21 01:58:09	Name: _cc_id Value: e892471a0e85b5173c586ecb825ddae7
.bluekai.com/	1970-01-20 23:54:18	Name: bku Value: +rQ99mk7OtSp3HXB
.onaudience.com/	1970-01-21 04:14:57	Name: cookie Value: 5919850d00101870
.onaudience.com/	1970-01-20 19:30:47	Name: done_redirects109 Value: 1
.doubleclick.net/	1970-01-21 05:05:21	Name: IDE Value: AHWqTUk00Tdnfd195GsXQ3oyvhDDfWQdf3SUY8P_Ny8fXBiwg9ahTPqyeizbWyA0lYc
.intentiq.com/	1970-01-21 05:05:21	Name: IQver Value: 1.9
.liadm.com/	1970-01-21 05:05:21	Name: lidid Value: 5ef81211-c4b8-4025-b698-8d908aa1734d
.linkedin.com/	1970-01-20 21:38:57	Name: li_sugr Value: 545913c9-559e-43b6-a1b0-8c321336a7a5
.linkedin.com/	1970-01-21 04:14:57	Name: bcookie Value: "v=2&9aad0a9b-39c6-42fa-8460-153ae9bf1f41"
.linkedin.com/	1970-01-20 19:30:47	Name: lidc Value: "b=OGST02:s=O:r=O:a=O:p=O:g=3192:u=1:x=1:i=1711761387:t=1711847787:v=2:sig=AQEjGLWhH59GTPeUTUe481YfNGv5g0wM"
.rezync.com/	1970-01-21 04:50:57	Name: zync-uuid Value: 87e27168-f1d7-4beb-a884-8db65a6ff223:1711761387.9673643
.t.sharethis.com/	1969-12-31 23:59:59	Name: pxcelBcnLcy Value: 70
.lijit.com/	1970-01-21 04:14:57	Name: _ljtrtb_2 Value: 49DBE3392DC240ABA420ABA7428B6F9E
.rfihub.com/	1970-01-21 04:50:57	Name: rud Value: H4sIAAAAAAAA_-MSsjQ3MDA2NjQ3sTS2MDcxsDA3FuIz1M31K06LNC61yIhPMQMABX9JliQAAAA
.rfihub.com/	1969-12-31 23:59:59	Name: euds Value: H4sIAAAAAAAA_wXBwQ3AMAgDwE_XoZKBYLfbJEoYpJP37rsoHidK1ti0XGfZlNK0V41Z3e7xggALId5PMSrjB-bpmHY6AAAA
.rfihub.com/	1969-12-31 23:59:59	Name: ruds Value: H4sIAAAAAAAA_-MSsjQ3MDA2NjQ3sTS2MDcxsDA3FuIz1M31K06LNC61yIhPMQMABX9JliQAAAA
live.rezync.com/	1970-01-21 04:50:57	Name: sd-session-id Value: .eJwNzEEKwyAQQNG7zDoWR60zepmgdQRpY0tMNg29e11--LwL1o_sW-rSD4jHfsoCj1ebNSBeMNp3kydECKS1tUguWCanmSz8FhgyRnv3tZW5MIkh9KwqFlIuS1aJ2Sku2d-Tr9UYG5EQyeNEbsGT9W46f5J1JYk.Zgdn7A._h2dGSoPz9r-R7riGjtO51XqYaY
.lijit.com/	1970-01-21 04:14:57	Name: _ljtrtb_5001 Value: e892471a0e85b5173c586ecb825ddae7
.crwdcntrl.net/	1970-01-21 01:58:09	Name: _cc_cc Value: "ACZ4XmNQSLWwNDIxN0w0SLUwTTI1NDdONrUwS01OsjAyTUlJTDVnAII09vS3f%2F7%2F%2F88P4oAB37rWncbMe7QY%2FjMyfpQFkdvrQSTDvQ%2BW2ITPHT3EjE3858YpLNjEL516xIZNfPe%2BywJMyNYyHF48B6sJd9c%2B5cZmwrslc1hQTWj4r4lN4cIZB5iwif%2Fr0sImfB7oDlgg3AC6HsYGAGATd0g%3D"
.crwdcntrl.net/	1970-01-21 01:58:09	Name: _cc_aud Value: "ABR4XmNgYGBIY09%2FC6QggJ2BgWsGmLmoFUQyas2GULNAFJ%2B7A5j3sB5E8evsB5IAAr4IDQ%3D%3D"
.fcliveevents.in/	1970-01-21 01:58:09	Name: _cc_id Value: e892471a0e85b5173c586ecb825ddae7
.fcliveevents.in/	1970-01-20 19:30:47	Name: panoramaId_expiry Value: 1711847789292
.fcliveevents.in/	1970-01-20 19:30:47	Name: panoramaId Value: cc0d2c11d94b66737f9d15da2c91a9fb927a63435c67cacc34f401bbef2e2cfb
.fcliveevents.in/	1970-01-20 19:30:47	Name: panoramaIdType Value: panoDevice
.everesttech.net/	1970-01-21 04:14:57	Name: everest_g_v2 Value: g_surferid~Zgdn7QACPAzVcgBi
.yahoo.com/	1970-01-21 04:15:18	Name: A3 Value: d=AQABBO1nB2YCEJFbDod_wk9D9CxmF04A5HIFEgEBAQG5CGYRZtxH0iMA_eMAAA&S=AQAAAgf_v36ls1saDvqkwu6skCw
.adnxs.com/	1970-01-20 21:38:57	Name: XANDR_PANID Value: sojHSx5eHvvh_xSEUDLoYXERnylfGLH2vJUz7V19IFA8bC9cmZ5VrmFbB9c0s33QjxHUpugGT2kEZE8DwuV2iRCZsakUb8mvw84zw8CqBQc.
.adnxs.com/	1970-01-21 05:05:21	Name: receive-cookie-deprecation Value: 1
.adnxs.com/	1970-01-20 21:38:57	Name: uuid2 Value: 5134189823149296003
.tapad.com/	1970-01-20 20:55:45	Name: TapAd_TS Value: 1711761390767
.tapad.com/	1970-01-20 20:55:45	Name: TapAd_DID Value: e2c038b6-ab3f-4577-be0d-9b576894ecfe
.truoptik.com/	1970-01-21 04:14:57	Name: to_master_s Value: 785791fb6b0e0fcf74324baef986151f
.truoptik.com/	1970-01-21 04:14:57	Name: to_version_s Value: b2
.demdex.net/	1970-01-20 23:48:33	Name: demdex Value: 70896552975976538043328497421494208728
.amazon-adsystem.com/	1970-01-20 23:55:45	Name: ad-id Value: A0QKRnqoA0nflOA4BgHN6uQ
.amazon-adsystem.com/	1970-01-21 05:05:21	Name: ad-privacy Value: 0
.ipredictive.com/	1970-01-21 04:14:57	Name: cu Value: da1997c6-3060-44ff-8cb7-102387828dbc\|1711761390824
.smartadserver.com/	1970-01-21 04:14:57	Name: TestIfCookieP Value: ok
.smartadserver.com/	1970-01-21 04:14:57	Name: pbw Value: %24b%3d16999%3b%24o%3d99999
.pubmatic.com/	1970-01-21 04:14:57	Name: KADUSERCOOKIE Value: 167413B5-E0AD-48CD-A4E6-761B801AB5E2
.dpm.demdex.net/	1970-01-20 23:48:33	Name: dpm Value: 70896552975976538043328497421494208728
.thrtle.com/	1970-01-21 00:17:21	Name: mc Value: eyJpZCI6IjMzZDU4YjlhLTQ0MTItNDk5Yy05NGViLThlZTg0NTNiYTc4MSIsImwiOjE3MTE3NjEzOTA5NjMsInQiOjJ9
.thrtle.com/	1970-01-21 00:17:21	Name: sc Value: eyJpIjoiMzNkNThiOWEtNDQxMi00OTljLTk0ZWItOGVlODQ1M2JhNzgxIiwic2lkIjoic2lkLTIzZmRhODc5LWVlMzMtMTFlZS05ZGMwLTAyNDIwYWZmMDAyYiIsIm1zIjoxLCJwcyI6MSwic3AiOjUwNDIsInBwIjoxLCJ0c2UiOjEsImx0c2UiOjE3MTE3NjEzOTAyMDJ9
.lijit.com/	1970-01-21 04:14:57	Name: ljtrtbexp Value: eJxdkDEWgDAIQ%2B%2FS2QFaIODVfN7dp3Yh4w%2BQANcojFOhsyBVcgyV2QUoN6wuGDHi5xWhL1ftDE0DtpJkGp1TKKOoTplpxE5M%2FpPmPfeGYv7Vgxh0U3vS%2FQBVgUCJ
.smartadserver.com/	1970-01-21 04:14:57	Name: pid Value: 3461039197791390975
.tapad.com/	1970-01-20 20:55:45	Name: TapAd_3WAY_SYNCS Value: 1!2161
.clickagy.com/	1970-01-21 05:05:21	Name: cb Value: Zgdn8K-NOPTDfGK-X8TUL4Lv
.adform.net/	1970-01-20 20:13:59	Name: C Value: 1
.c.cintnetworks.com/	1970-01-20 19:29:24	Name: TiPMix Value: 98.76251357627899
.c.cintnetworks.com/	1970-01-20 19:29:24	Name: x-ms-routing-name Value: self
sync.srv.stackadapt.com/	1970-01-21 04:14:57	Name: sa-user-id Value: s%3A0-4ac35646-c984-5bca-403a-4c1bcae8698e.nLLj57CHVxQ1HKqRLlV3a5Ej6xn%2Fy2Xd1V64v4xF7%2F8
.srv.stackadapt.com/	1970-01-21 04:14:57	Name: sa-user-id Value: s%3A0-4ac35646-c984-5bca-403a-4c1bcae8698e.nLLj57CHVxQ1HKqRLlV3a5Ej6xn%2Fy2Xd1V64v4xF7%2F8
sync.srv.stackadapt.com/	1970-01-21 04:14:57	Name: sa-user-id-v2 Value: s%3ASsNWRsmEW8pAOkwbyuhpjiaEdkg.XSzBvoOPXXn12c2ZZolIyorybLoWtehvUDbK0nfV0%2F0
.srv.stackadapt.com/	1970-01-21 04:14:57	Name: sa-user-id-v2 Value: s%3ASsNWRsmEW8pAOkwbyuhpjiaEdkg.XSzBvoOPXXn12c2ZZolIyorybLoWtehvUDbK0nfV0%2F0
sync.srv.stackadapt.com/	1970-01-21 04:14:57	Name: sa-user-id-v3 Value: s%3AAQAKIN1OI74s8Z-kwMj_HOAbx6y1IT3566KermxgZTb_yZfpEGcYBCDwz52wBjABOgSw8hAxQgQl28Mz.0qvyMOETCxa6qIEPmUWfYkJsp24KJdFEnG%2FCTB4Dnd8
.srv.stackadapt.com/	1970-01-21 04:14:57	Name: sa-user-id-v3 Value: s%3AAQAKIN1OI74s8Z-kwMj_HOAbx6y1IT3566KermxgZTb_yZfpEGcYBCDwz52wBjABOgSw8hAxQgQl28Mz.0qvyMOETCxa6qIEPmUWfYkJsp24KJdFEnG%2FCTB4Dnd8
.lijit.com/	1970-01-21 04:14:57	Name: _ljtrtb_76 Value: f68274bc-7231-4338-8c17-22adc47257d5
.lijit.com/	1970-01-21 04:14:57	Name: _ljtrtb_84 Value: Zgdn8K-NOPTDfGK-X8TUL4Lv
.turn.com/	1970-01-20 23:48:33	Name: uid Value: 3891680312294541726
.sitescout.com/	1970-01-21 04:14:57	Name: ssi Value: 708b3128-e0a8-4f32-bedf-0844ac00275f#1711761392306
.adform.net/	1970-01-20 20:55:45	Name: uid Value: 6737232825810021564
.media6degrees.com/	1970-01-20 23:48:33	Name: clid Value: 2sb4zjk01170g9uhs8b1v4u5000000012h010d01301
.media6degrees.com/	1970-01-20 23:48:33	Name: acs Value: 012020k1sb4zjkxzt10
.quantserve.com/	1970-01-21 04:59:35	Name: mc Value: 660767f0-5cb13-e7615-eeb35
.contextweb.com/	1970-01-21 04:07:45	Name: V Value: lEhyBgOu1Dsr
.contextweb.com/	1970-01-21 04:07:45	Name: VP Value: part_lEhyBgOu1Dsr
bh.contextweb.com/	1969-12-31 23:59:59	Name: INGRESSCOOKIE Value: 26a12b5bc816461f
.rubiconproject.com/	1970-01-20 21:38:57	Name: receive-cookie-deprecation Value: 1
.lijit.com/	1970-01-21 04:14:57	Name: _ljtrtb_5 Value: 0g9uhs8b1v4u5
.lijit.com/	1970-01-21 04:14:57	Name: _ljtrtb_43 Value: bpYuIm6XeCV1lX13aZMzcG-WLyB1xXt3a5WH_S64
.lijit.com/	1970-01-21 04:14:57	Name: _ljtrtb_49 Value: lEhyBgOu1Dsr
.lijit.com/	1970-01-21 04:14:57	Name: _ljtrtb_80 Value: LUDEJBJS-D-86MR
.pubmatic.com/	1970-01-20 21:38:57	Name: chkChromeAb67Sec Value: 1
.pubmatic.com/	1970-01-20 19:30:47	Name: pi Value: 137711:3
.pubmatic.com/	1970-01-20 21:38:57	Name: DPSync3 Value: 1712966400%3A201_263%7C1711843200%3A248%7C1712361600%3A265
.pubmatic.com/	1970-01-20 21:38:57	Name: SyncRTB3 Value: 1712966400%3A13_3_5_266_231_233_71_166_178_165_104_46_22_240_249_176_8_55_56_48_220_21_54_250%7C1714348800%3A224%7C1712361600%3A223_15_2%7C1712620800%3A63%7C1713052800%3A35
.bidr.io/	1970-01-21 04:57:54	Name: bito Value: AAErnU7MDtAAABQ3eWRCrQ
.bidr.io/	1970-01-21 04:57:54	Name: bitoIsSecure Value: ok
.adx.opera.com/	1970-01-21 04:14:57	Name: UID Value: OPU7a905280ba50413b97d29cdd958eee3c
.creativecdn.com/	1970-01-21 04:14:57	Name: g Value: JBwPx9QtN6Dwmscu1N6l_1711761392541
.creativecdn.com/	1970-01-21 04:14:57	Name: ts Value: 1711761392
.bidswitch.net/	1970-01-21 04:14:57	Name: tuuid Value: c8f502eb-070d-4265-b99e-ac66f89e2d09
.bidswitch.net/	1970-01-21 04:14:57	Name: c Value: 1711761392
.bidswitch.net/	1970-01-21 04:14:57	Name: tuuid_lu Value: 1711761392
.lijit.com/	1970-01-21 04:14:57	Name: _ljtrtb_85 Value: AAErnU7MDtAAABQ3eWRCrQ
.lijit.com/	1970-01-21 04:14:57	Name: _ljtrtb_103 Value: OPU7a905280ba50413b97d29cdd958eee3c
.rubiconproject.com/	1970-01-21 04:14:57	Name: khaos Value: LUDEJBRV-23-3OER
.rubiconproject.com/	1970-01-21 04:14:57	Name: audit Value: 1\|m7xy43qfHeDhKf/1pkUGKAsjjaxCNWwu/98QN5DNmOqbz16xSA9sXcnVOjr4DjYgeACJNXzTBxxCqQ3+tQhlLHMDvubSxZCG6XkpxWjLVqA2lbIZpOyshevdGJvCae5zoxw3IrM1QdF01qAbJMnMkb36B19O7vOZ3sp+uxZOeRk6MWqnocaYWw==
.lijit.com/	1970-01-21 04:14:57	Name: _ljtrtb_16 Value: 708b3128-e0a8-4f32-bedf-0844ac00275f-660767f0-5553
aorta.clickagy.com/	1970-01-21 05:05:21	Name: chs Value: [{"ch":"185","t":"2024-03-30 01:16:32"},{"ch":"5","t":"2024-03-30 01:16:32"},{"ch":"4","t":"2024-03-30 01:16:32"}]
.sitescout.com/	1970-01-20 20:12:33	Name: _ssuma Value: eyI0NSI6MTcxMTc2MTM5Mjg3NywiNyI6MTcxMTc2MTM5MjM5Mn0
.adsrvr.org/	1970-01-21 04:14:57	Name: TDCPM Value: CAESFgoHYmx1ZWthaRILCNLh5d2hmOg8EAUSFAoFdGFwYWQSCwjqms-HopjoPBAFEhcKCHB1Ym1hdGljEgsIoJSQmqKY6DwQBRgBIAEoAjILCNiKk8e4mOg8EAU4AVoIcHVibWF0aWNgAg..
.analytics.yahoo.com/	1970-01-21 04:14:57	Name: IDSYNC Value: "19cl~2hkp:19bk~2hkp:18z8~2hkp"
.lijit.com/	1970-01-21 04:14:57	Name: _ljtrtb_86 Value: r6U9tPEuZYLlt-mj0dooQY6hPNq1spdxDWO1UgIAoZA
.lijit.com/	1970-01-21 04:14:57	Name: _ljtrtb_83 Value: LUDEJBRV-23-3OER
.lijit.com/	1970-01-21 04:14:57	Name: _ljtrtb_27 Value: cba85754-2b38-48f3-8e98-6a1492b11d52
.lijit.com/	1970-01-21 04:14:57	Name: _ljtrtb_58 Value: 167413B5-E0AD-48CD-A4E6-761B801AB5E2
.quantserve.com/	1970-01-20 21:38:57	Name: d Value: EOMBEgG_K_ijDejbEA
.3lift.com/	1970-01-20 21:38:57	Name: tluidp Value: 4328813047419407572631
.3lift.com/	1970-01-20 21:38:57	Name: tluid Value: 4328813047419407572631
.adentifi.com/	1970-01-21 05:05:21	Name: adtheorent[cuid] Value: cuid_255bcca3-ee33-11ee-aa11-12a7adfcdbeb
.tribalfusion.com/	1970-01-20 21:38:57	Name: ANON_ID Value: aTnv7yNj6WlCyhURB5xU20GvLOfZbUREG6H036L2ZaYauVJjPCi80WW83sUOyaUZdScZajc74eoItoiHMLIcETOa8poHKrLdUlZdDun4pFyZbaAK4qZbPbJG253
.creative-serving.com/	1970-01-21 04:07:45	Name: tuuid Value: 6cd3afba-6158-4f31-aaa4-b53f06db59cb
.creative-serving.com/	1970-01-21 04:07:45	Name: c Value: 1711761393
.creative-serving.com/	1970-01-21 04:07:45	Name: tuuid_lu Value: 1711761393
.lijit.com/	1970-01-21 04:14:57	Name: _ljtrtb_97 Value: OPTOUT
.rfihub.com/	1970-01-21 04:50:57	Name: eud Value: H4sIAAAAAAAA_13MsRGAIBBE0bEAI-o4Z46D28VuYICCDA0twQqNNDD8wfv3sipU4WrFrOgRQIwIdcrUDkltNKlkEvbmufqcMdr-ImIrDvNkZ_hOZMz5-vUDEYvTfGoAAAA
.pubmatic.com/	1970-01-20 20:12:33	Name: KRTBCOOKIE_632 Value: 23041-r6U9tPEuZYLlt-mj0dooQY6hPNq1spdxDWO1UgIAoZA&KRTB&23047-r6U9tPEuZYLlt-mj0dooQY6hPNq1spdxDWO1UgIAoZA&KRTB&23234-r6U9tPEuZYLlt-mj0dooQY6hPNq1spdxDWO1UgIAoZA&KRTB&23361-r6U9tPEuZYLlt-mj0dooQY6hPNq1spdxDWO1UgIAoZA
.pubmatic.com/	1970-01-20 21:38:57	Name: KRTBCOOKIE_377 Value: 6810-cba85754-2b38-48f3-8e98-6a1492b11d52&KRTB&22918-cba85754-2b38-48f3-8e98-6a1492b11d52&KRTB&22926-cba85754-2b38-48f3-8e98-6a1492b11d52&KRTB&23031-cba85754-2b38-48f3-8e98-6a1492b11d52
.pubmatic.com/	1970-01-20 21:38:57	Name: KRTBCOOKIE_860 Value: 16335-SsNWRsmEW8pAOkwbyuhpjiaEdkg&KRTB&23334-SsNWRsmEW8pAOkwbyuhpjiaEdkg&KRTB&23417-SsNWRsmEW8pAOkwbyuhpjiaEdkg&KRTB&23426-SsNWRsmEW8pAOkwbyuhpjiaEdkg
.pubmatic.com/	1970-01-20 20:12:33	Name: KRTBCOOKIE_22 Value: 14911-3891680312294541726&KRTB&23150-3891680312294541726&KRTB&23527-3891680312294541726
.pubmatic.com/	1970-01-20 20:12:33	Name: KRTBCOOKIE_391 Value: 22924-6737232825810021564&KRTB&23263-6737232825810021564&KRTB&23481-6737232825810021564
.pubmatic.com/	1970-01-20 20:12:33	Name: KRTBCOOKIE_279 Value: 22890-da1997c6-3060-44ff-8cb7-102387828dbc&KRTB&23011-da1997c6-3060-44ff-8cb7-102387828dbc&KRTB&23355-da1997c6-3060-44ff-8cb7-102387828dbc
.deepintent.com/	1970-01-21 05:05:21	Name: CDIUSER Value: di_6ca1bb4c816d4902b5f5f
.deepintent.com/	1970-01-21 05:05:21	Name: CDIPARTNERS Value: %7B%221%22%3A%2220240330%22%7D
.pubmatic.com/	1970-01-20 21:38:57	Name: KRTBCOOKIE_188 Value: 3189-708b3128-e0a8-4f32-bedf-0844ac00275f-660767f0-5553&KRTB&23418-708b3128-e0a8-4f32-bedf-0844ac00275f-660767f0-5553
.pubmatic.com/	1970-01-20 20:12:33	Name: KRTBCOOKIE_148 Value: 19421-uid:49DBE3392DC240ABA420ABA7428B6F9E&KRTB&23486-uid:49DBE3392DC240ABA420ABA7428B6F9E&KRTB&23489-uid:49DBE3392DC240ABA420ABA7428B6F9E&KRTB&23539-uid:49DBE3392DC240ABA420ABA7428B6F9E
.pubmatic.com/	1970-01-20 21:38:57	Name: KRTBCOOKIE_153 Value: 1923-A982ngPeYJkY3GXLBNorzALfN5wYjGPLBtwLcuoq&KRTB&19420-A982ngPeYJkY3GXLBNorzALfN5wYjGPLBtwLcuoq&KRTB&22979-A982ngPeYJkY3GXLBNorzALfN5wYjGPLBtwLcuoq&KRTB&23462-A982ngPeYJkY3GXLBNorzALfN5wYjGPLBtwLcuoq
.pubmatic.com/	1970-01-20 21:38:57	Name: KRTBCOOKIE_80 Value: 22987-CAESEJhGV1KQkoCwBR4qycfAmsM&KRTB&23025-CAESEJhGV1KQkoCwBR4qycfAmsM&KRTB&23386-CAESEJhGV1KQkoCwBR4qycfAmsM
.adgrx.com/	1970-01-21 04:58:09	Name: ADGRX_UID Value: 2570f5b2-ee33-11ee-8053-f376304179ac
.dotomi.com/	1970-01-20 19:29:21	Name: DotomiTest Value: b4c6b8480e306ac
.mxptint.net/	1970-01-21 05:05:21	Name: mxpim Value: R33647_1132A54C6_A6642848.1.0000000000000000660767F1
.krushmedia.com/	1970-01-20 19:49:30	Name: krm_usr Value: a227433a-4c5e-59a2-87bd-ce1928abe993
.krushmedia.com/	1970-01-20 19:49:30	Name: krm_r Value: 572
.w55c.net/	1970-01-21 04:59:35	Name: wfivefivec Value: zLWxSvEa1RQnkJ5
.pubmatic.com/	1970-01-20 20:12:33	Name: KRTBCOOKIE_52 Value: 22772-R33647_1132A54C6_A6642848&KRTB&23092-R33647_1132A54C6_A6642848
.pubmatic.com/	1970-01-20 21:38:57	Name: KRTBCOOKIE_1278 Value: 23329-4173c59c-85ff-49c8-9962-55ef6a2b7957&KRTB&23340-4173c59c-85ff-49c8-9962-55ef6a2b7957&KRTB&23498-4173c59c-85ff-49c8-9962-55ef6a2b7957
.pubmatic.com/	1970-01-20 21:38:57	Name: KRTBCOOKIE_18 Value: 22947-970033174938740873
.adgrx.com/	1970-01-20 19:30:47	Name: ADGRX_CM_PUBMATIC_BRIDGED Value: 1
.w55c.net/	1970-01-20 20:12:33	Name: matchpubmatic Value: 5
.lijit.com/	1970-01-21 04:14:57	Name: _ljtrtb_102 Value: a227433a-4c5e-59a2-87bd-ce1928abe993
beacon.lynx.cognitivlabs.com/	1970-01-21 04:14:57	Name: UID Value: 81ee098e-876f-4035-a14d-075f5aec39a4
beacon.lynx.cognitivlabs.com/	1970-01-21 04:14:57	Name: ss Value: AvIVxobcp2HHSanjINpcMs4CW6vPYmsgwsM6zb5QV5ftm5W6YkSdto4tJnz3lTaAwGBs%2BLPq69dNZyzwB7ktIg%3D%3D
.pubmatic.com/	1970-01-20 21:38:57	Name: KRTBCOOKIE_32 Value: 11175-AAACWSVUV10poAMGgVUJAAAAAAA&KRTB&22713-AAACWSVUV10poAMGgVUJAAAAAAA&KRTB&22715-AAACWSVUV10poAMGgVUJAAAAAAA&KRTB&23519-AAACWSVUV10poAMGgVUJAAAAAAA
.pubmatic.com/	1970-01-20 21:38:57	Name: KRTBCOOKIE_107 Value: 1471-uid:zLWxSvEa1RQnkJ5&KRTB&23421-uid:zLWxSvEa1RQnkJ5
.pubmatic.com/	1970-01-20 21:38:57	Name: KRTBCOOKIE_1003 Value: 22761-2570f5b2-ee33-11ee-8053-f376304179ac&KRTB&23275-2570f5b2-ee33-11ee-8053-f376304179ac
.lijit.com/	1970-01-21 04:14:57	Name: ljtrtb Value: eJw9kUlvGzEMRv%2BLzyUgURvV24xnmiaxM47jiZdLoW1sFE6cegmSFv3vlXzoRYfHR5H4%2BGekaPR1xLWRXNQKWlY1IGncQCVbDUbzmhivatXi6MtIMcaznciiNNyxRMorbkRQpFPwhCpGl0w2uc6eYeQFR4LEHIEcBIJPcQBGUrrAGBo1gNbMaDMwUEqJ3Clt7ty3u8962114czpmhiaz4B0poySgF%2Fk3GgRQsgTacWnRcx5V2RGzKm1Tt0JYbMYoWVVXEstrJFKtv9m2LMiK6BCNFMKBDCqBsg6BjI8QErdIzidrxVUWWe5mvXGWKSTmnWI5MG9NRBtitIpSSiKUjLLJtvayO5Hn7%2FKiMiOW4aRv2rv67gkaID2dFyz%2B4%2FkzoADRtVcuM99s4yvdw0M3WzTDzT2saNFP5OS91MuMqmqPr72ZNueqqupHkZbz8fExV6257rro%2BkVxyyGOurfnWXvZrCf7M7z8ZPFweFzr3ezhFz%2B9xY9m2fF%2Be1sdNlW5QFnLv60vty96lcbPfL%2Fiwm2mv8MNLCefNf9YnYVTy%2B8%2FnrTMvikjBk05Sh%2FAoOCQMyWgwA0guhikQWWiGv39B7OdnbM%3D
.lijit.com/	1970-01-21 04:14:57	Name: _ljtrtb_26 Value: c8f502eb-070d-4265-b99e-ac66f89e2d09
.technoratimedia.com/	1970-01-21 05:05:21	Name: tads_uidp_37 Value: b7e26a0e-6895-3ac0-a547-a5b1b716ac2b
.technoratimedia.com/	1970-01-21 05:05:21	Name: tads_uidp_44 Value: LUCCRQQZ-1U-D08N
.technoratimedia.com/	1970-01-21 05:05:21	Name: tads_uidp_46 Value: 7089776726253724747
.technoratimedia.com/	1970-01-21 05:05:21	Name: tads_uidp_48 Value: 0534973d-3830-4385-8df6-e6359aaafe0c
.technoratimedia.com/	1970-01-21 05:05:21	Name: tads_uidp_49 Value: AAACJDXbbevbYAMAajs8AAAAAAA
.technoratimedia.com/	1970-01-21 05:05:21	Name: tads_uidp_50 Value: 471d738f-2852-0a17-0671-796c6fc2eb23
.technoratimedia.com/	1970-01-21 05:05:21	Name: tads_uidp_61 Value: 212532609066557
.technoratimedia.com/	1970-01-21 05:05:21	Name: tads_uidp_62 Value: 3546995631523745000V10
.technoratimedia.com/	1970-01-21 05:05:21	Name: tads_uidp_64 Value: 6H6o6lQwkE10zVNpd94pGHtcv6p121Lx
.technoratimedia.com/	1970-01-21 05:05:21	Name: tads_uidp_7 Value: bfd6567e-c559-44d7-9f20-4181ca696eaf
.technoratimedia.com/	1970-01-21 05:05:21	Name: tads_uidp_73 Value: AAErnU7MDtAAABQ3eWRCrQ
.technoratimedia.com/	1970-01-21 05:05:21	Name: tads_uidp_76 Value: RX-3ff55c13-7f89-4c8d-9626-2392a016478a-005
.technoratimedia.com/	1970-01-20 19:33:40	Name: tads_uidp_80 Value: y-elp4w7JE2uGj.nQQNAtuvzBGC5lvswG4~A
.technoratimedia.com/	1970-01-20 19:33:40	Name: tads_uidp_82 Value: ZgURNdHM74cAADOAACvJHwAA&565
.technoratimedia.com/	1970-01-20 19:33:40	Name: tads_uidp_88 Value: 3961602615401983652468
.technoratimedia.com/	1970-01-21 05:05:21	Name: tads_uid Value: C6D4566B393F48B48664DCE5F8A9A2D8
.technoratimedia.com/	1970-01-21 05:05:21	Name: tads_uid_cd Value: 20240311155613+0000
.technoratimedia.com/	1970-01-21 05:05:21	Name: tads_zora Value: 2
.nrich.ai/	1970-01-21 05:05:21	Name: _nauid Value: cde31909-58a4-4e58-a755-01fd9ddb0318
.smartadserver.com/	1970-01-21 04:14:57	Name: csync Value: 127:AAErnU7MDtAAABQ3eWRCrQ
.pubmatic.com/	1970-01-20 21:38:57	Name: KRTBCOOKIE_466 Value: 16530-c8f502eb-070d-4265-b99e-ac66f89e2d09
.contextweb.com/	1970-01-21 04:14:57	Name: pb_rtb_ev Value: 3-1qik\|7dN.0.AAErnU7MDtAAABQ3eWRCrQ\|7dW.0.1
.contextweb.com/	1970-01-21 04:14:57	Name: pb_rtb_ev_part Value: 3-1qik\|7dN.0.AAErnU7MDtAAABQ3eWRCrQ\|7dW.0.1
.pubmatic.com/	1970-01-20 21:38:57	Name: KRTBCOOKIE_699 Value: 22727-AAErnU7MDtAAABQ3eWRCrQ
.pubmatic.com/	1970-01-20 20:12:33	Name: PugT Value: 1711761394
.pubmatic.com/	1970-01-20 20:12:33	Name: SPugT Value: 1711761394

1001 Console Messages

A page may trigger messages to the console to be logged. These are often error messages about being unable to load a resource or execute a piece of JavaScript. Sometimes they also provide insight into the technology behind a website.

Source	Level	URL Text
recommendation	verbose	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: [DOM] Password field is not contained in a form: (More info: https://goo.gl/9p2vKq) %o
network	error	URL: https://voddvrcdn.viewliveevents.in/voddvr/jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/playlist_dvr.m3u8 Message: Failed to load resource: the server responded with a status of 404 (Not Found)
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
network	error	URL: https://voddvrcdn.viewliveevents.in/voddvr/jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/playlist_dvr.m3u8 Message: Failed to load resource: the server responded with a status of 404 (Not Found)
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
security	error	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Refused to execute script from 'https://track2.securedvisit.com/sync/1540_03681?id=IZ6MASZHEJmM2GwjRW6x-cEw' because its MIME type ('image/gif') is not executable.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://jahnaviwithsaathwiksamala.appvideo.fcliveevents.in/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.

Indicators

This is a term in the security industry to describe indicators such as IPs, Domains, Hashes, etc. This does not imply that any of these indicate malicious activity.

a.dtssrv.com
a.tribalfusion.com
analytics.google.com
ap.lijit.com
api.intentiq.com
bcp.crwdcntrl.net
cdn-tc.33across.com
cdn.lijit.com
cdn.tynt.com
ce.lijit.com
cm.g.doubleclick.net
cms.analytics.yahoo.com
connect-metrics-collector.s-onetag.com
d39c1tueofpvm6.cloudfront.net
data-beacons.s-onetag.com
de.tynt.com
e.dtscout.com
get.s-onetag.com
i.liadm.com
i.simpli.fi
ib.adnxs.com
ic.tynt.com
idpix.media6degrees.com
idsync.rlcdn.com
jahnaviwithsaathwiksamala.appvideo.fcliveevents.in
lex.33across.com
live.rezync.com
match.adsrvr.org
onetag-geo.s-onetag.com
p.rfihub.com
pd.sharethis.com
pippio.com
pixel.onaudience.com
ps.eyeota.net
px.ads.linkedin.com
rc.rlcdn.com
s.tribalfusion.com
s10.histats.com
s4.histats.com
stats.g.doubleclick.net
sync-tm.everesttech.net
t.dtscdn.com
t.dtscout.com
t.sharethis.com
tags.bluekai.com
tags.crwdcntrl.net
thrtle.com
track2.securedvisit.com
um.simpli.fi
ups.analytics.yahoo.com
us-u.openx.net
voddvrcdn.viewliveevents.in
www.google-analytics.com
www.google.com
www.googletagmanager.com
104.18.25.173
104.18.35.167
107.178.254.65
108.138.106.51
108.138.128.28
108.138.128.34
108.139.29.87
108.139.47.115
13.226.34.99
141.94.171.214
149.56.240.127
15.197.193.217
151.101.130.49
172.64.153.173
172.67.163.146
173.194.219.156
18.173.132.31
18.238.55.108
18.238.55.22
199.38.167.130
2001:4860:4802:32::178
2001:4860:4802:32::181
216.219.95.231
23.198.214.73
23.198.214.81
23.37.233.35
2600:9000:2209:c000:1f:8466:d380:21
2606:4700:10::6814:4373
2606:4700:20::681a:d3c
2606:4700:21::8d65:780b
2606:4700:4400::ac40:97ee
2607:f8b0:4002:c0f::61
2607:f8b0:4002:c1b::9d
2620:1ec:21::14
3.19.195.77
3.224.87.131
3.235.217.129
34.200.65.202
34.86.110.8
34.98.64.218
35.194.66.159
35.244.154.8
44.209.254.124
44.210.227.34
5.75.143.77
50.16.174.192
52.203.90.63
52.3.41.35
54.234.166.1
64.233.185.99
67.202.105.23
67.202.105.31
67.202.105.32
68.67.160.186
75.2.13.80
08b479c3eeb1cb4d44354e6bf17322cd7acd38ae9a33ee5956898447ed43fab6
0913abf402e9b4288b864d7e28eb708cfa516900d6f6bf356b5688978b9b8e65
0af3aae90b7de9fdceee2ab421378ea2f54c74be81ef43fc6c1790a032755d80
0b06ca55c1eb4674bf666bee6cd0193d8e72d3ed8535b7b5df6160e0391d84fc
12bb4c039d2eb8a68fc15fc387f237426adbb33f565768fd69b781302fb4751a
145287b36883dd3061ca7aa9229a8fa9ace2cccd50e0382b4b6201f3916b57c5
1633daaabd15713163bdacb40896cb75d3969d1a0007b55e7f0a05f5304fa228
1f32f116118f986dd762a1a2606c3c1364c03df304c4afa7a59dba8ff9bcd50a
1f4513a435d6a3047d20a50c1e7d4263de42146c74be227f774b5e82e6357e75
2defe59e357a7d0683c8283ac42841db404a0884cae2eaecebf4b676e559dede
2e35407520113047f4d0ab1680ecf94a285113dfcb475b4c349399335e493979
3579fdf608da8b94dcde86b2bd83e6e14c563bb4a5496460b6ebdd4004d31ed4
3db5fc063868d3ca5fc3cc2695f483266cffea00bef68dffd7e4944b947aacc8
3e10785d98d186776a472de99e3efc2537b3be807655ba39a9d61880df628e12
3eb10792d1f0c7e07e7248273540f1952d9a5a2996f4b5df70ab026cd9f05517
43b6f7fc9d6dc4829c4d965ea45257e8cd987e145f080db398007680255f63bd
45748637407a98f88b7f018df62ac8c0a8dd4743b39f0d8f4a64143c498161a5
4735c4e647a5fbf02419108212b4a35c4462430a862cc3d30577eb2e6eb7d9d9
48c0bf8e1b336176562a8daf8749f07554f8de821bce7e8c224a1c54d0bb65de
4b6bcea07fb26c85c0ab9c4cbba54a5a10fa87338d8f4f401217090b7d256fd1
4cf840b394056ee36af233641990167f4c9a41292f42318c1da5b1bc5ed68d76
52e8c50e4b27e18e3793d48c223fa585529626eea9658db36ad5acd1e866ff6f
53964478a7c634e8dad34ecc303dd8048d00dce4993906de1bacf67f663486ef
6068f86ff5e6d3a3e100e95fd0ab03a5fb9ebfca9386b2c0ee131361a62526c2
621d6975d9231c0b51ce05afb7e1471de90ab3e1e658b0a231b55c819c98ef79
6b67fa3f010bd41b15b11812c97dd1b7b3d03c5b88bc6c1c4f889eb62966069f
717f6bb5f6cc69c444f54376a72dee0ca7968b2a12e7c9475247ec85c0e75a53
72a4c487e9ba6a85f801e702bac513851d6e74d12bc1bfcda65854d831e2bf8c
7434e264045ea93d86272cc9aeea1d0aa03e11bd49f658789b19d86f28136ace
7725538fe2f71147bffeba7452b434c826aef9009666cb4360c605d0b2a91d1d
81c6737ba56c1e094f3a71967b8c158fa54383b6a57e373e961967b264279c66
8337212354871836e6763a41e615916c89bac5b3f1f0adf60ba43c7c806e1015
834c49499fc3b4668a0e3a327ff90fd92bda0206103d2aaf3e6d15d29f5277b9
851a1aace07f995f5075846e18098478b6fe7c7e921e84747504ceb39f6a94b6
87083882cc6015984eb0411a99d3981817f5dc5c90ba24f0940420c5548d82de
8c8ce49ea0bca4a25c06125706d379cd2786025153ced2d4ddcf7a1a9f8a2972
91f94a3c7e05d1c1afd01260e88ebea5be6720ed3514c7a82bba96a33d4d6b21
a0c589946d84942306502e5ae80c7a349409836f7aee0e2faa5456e5607e0342
a9bb002b8d8261043b0157782d68e8d159482baf7eb3c20ddef606b1e6af2bb0
ab22cd01989ebab4166f91856fb9f07e9120a2ae7e2b025e460cad8ec956ae48
b1442e85b03bdcaf66dc58c7abb98745dd2687d86350be9a298a1d9382ac849b
b7f07fd410c361437f8322395645a33d3b4358a69f0aede57dbda7b4f94dbe8b
bd2a2141b31892909c0d018d2cf9e1138522f4723f0b31273f0d4bd303fe8b8a
c013d9cd6c21679c29a8e165b78b36b8279af7eb8f254a0cafd465cd09ece262
d692a67352a3dfa80010c86a62761cfff05c0b1086618106a8576cc45a6a8115
de3246094525b21a870fc7d2a67490d0132535c6fa5993755c549f1a9d1bd8af
de36e50194320a7d3ef1ace9bd34a875a8bd458b253c061979dd628e9bf49afd
de9d3fd0eb948bd294477d0eda60a73b85caff1794803530d0463193a113da98
e163818928211f02c67e6e681d6eaa2836d0b76bf6f7d788d2ac8b3559006cd1
e38dc477bf921713f2812cdeeae6657aac03d4a3b37d9db782feb9bc38421b5c
e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855
e714a355bf49cce7b25d53b7f773a44b2762ad804d2a91b5cc3f0f2d97b973b0
e822cdbdb0e7f6a40fa06e5492b5d68c11ed3bd2523f5f40fed171e6ee18f3d7
e8d215c2b0559a3984a64151d0eba137246e8b009bf60d7f015cc9384e08eb3b
ee13bc196aa9b9aaf12a903311c994b943e02bf0e2b18128f4196e1b51a058e2
ef1955ae757c8b966c83248350331bd3a30f658ced11f387f8ebf05ab3368629
ef44d61e110a20b1a231db1ba8696f543c21bcd0e4195d461fbdb399b74276f0
f3a29e09317f5d798f40757b353629ad44d67b82032b430aec17be6424f6325b
f4eef8263281c0b26486637831251059757bc3fdc4c3a48045a8ef8646b36e8f
f75e846cc83bd11432f4b1e21a45f31bc85283d11d372f7b19accd1bf6a2635c

jahnaviwithsaathwiksamala.appvideo.fcliveevents.in Open in urlscan Pro 216.219.95.231 Public Scan

Summary

urlscan.io Verdict: No classification

Domain & IP information

Screenshot Live screenshot Full Image

Page Title

Detected technologies

Page Statistics

82 Requests

78 %HTTPS

18 %IPv6

37 Domains

55 Subdomains

43 IPs

5 Countries

1168 kBTransfer

2543 kBSize

203 Cookies

1 Outgoing links

Redirected requests

82 HTTP transactions Everything HTML Script AJAX CSS Image Expand all 5 data transactions

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

jahnaviwithsaathwiksamala.appvideo.fcliveevents.in Open in urlscan Pro
216.219.95.231 Public Scan

Screenshot
Live screenshot

Full Image

82
Requests

78 %
HTTPS

18 %
IPv6

37
Domains

55
Subdomains

43
IPs

5
Countries

1168 kB
Transfer

2543 kB
Size

203
Cookies

82 HTTP transactions
5 data transactions