www.getaccept.com
Open in
urlscan Pro
2606:2c40::c73c:67e2
Public Scan
Submitted URL: http://getaccept.com/
Effective URL: https://www.getaccept.com/
Submission: On January 18 via manual from US — Scanned from DE
Effective URL: https://www.getaccept.com/
Submission: On January 18 via manual from US — Scanned from DE
Form analysis
8 forms found in the DOM<form>
<fieldset>
<legend class="visuallyhidden">Consent Selection</legend>
<div id="CybotCookiebotDialogBodyFieldsetInnerContainer">
<div class="CybotCookiebotDialogBodyLevelButtonWrapper"><label class="CybotCookiebotDialogBodyLevelButtonLabel" for="CybotCookiebotDialogBodyLevelButtonNecessary"><strong
class="CybotCookiebotDialogBodyLevelButtonDescription">Necessary</strong></label>
<div class="CybotCookiebotDialogBodyLevelButtonSliderWrapper CybotCookiebotDialogBodyLevelButtonSliderWrapperDisabled"><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonNecessary"
class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelButtonDisabled" disabled="disabled" checked="checked"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></div>
</div>
<div class="CybotCookiebotDialogBodyLevelButtonWrapper"><label class="CybotCookiebotDialogBodyLevelButtonLabel" for="CybotCookiebotDialogBodyLevelButtonPreferences"><strong
class="CybotCookiebotDialogBodyLevelButtonDescription">Preferences</strong></label>
<div class="CybotCookiebotDialogBodyLevelButtonSliderWrapper"><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonPreferences" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox"
data-target="CybotCookiebotDialogBodyLevelButtonPreferencesInline" checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></div>
</div>
<div class="CybotCookiebotDialogBodyLevelButtonWrapper"><label class="CybotCookiebotDialogBodyLevelButtonLabel" for="CybotCookiebotDialogBodyLevelButtonStatistics"><strong
class="CybotCookiebotDialogBodyLevelButtonDescription">Statistics</strong></label>
<div class="CybotCookiebotDialogBodyLevelButtonSliderWrapper"><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonStatistics" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox"
data-target="CybotCookiebotDialogBodyLevelButtonStatisticsInline" checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></div>
</div>
<div class="CybotCookiebotDialogBodyLevelButtonWrapper"><label class="CybotCookiebotDialogBodyLevelButtonLabel" for="CybotCookiebotDialogBodyLevelButtonMarketing"><strong
class="CybotCookiebotDialogBodyLevelButtonDescription">Marketing</strong></label>
<div class="CybotCookiebotDialogBodyLevelButtonSliderWrapper"><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonMarketing" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox"
data-target="CybotCookiebotDialogBodyLevelButtonMarketingInline" checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></div>
</div>
</div>
</fieldset>
</form>
<form><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonNecessaryInline" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelButtonDisabled" disabled="disabled" checked="checked"> <span
class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form>
<form><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonPreferencesInline" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox" data-target="CybotCookiebotDialogBodyLevelButtonPreferences"
checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form>
<form><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonStatisticsInline" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox" data-target="CybotCookiebotDialogBodyLevelButtonStatistics"
checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form>
<form><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonMarketingInline" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox" data-target="CybotCookiebotDialogBodyLevelButtonMarketing" checked="checked"
tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form>
<form class="CybotCookiebotDialogBodyLevelButtonSliderWrapper"><input type="checkbox" id="CybotCookiebotDialogBodyContentCheckboxPersonalInformation" class="CybotCookiebotDialogBodyLevelButton"> <span
class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form>
POST https://forms.hsforms.com/submissions/v3/public/submit/formsnext/multipart/541808/5f63f877-be5f-4e58-9005-ad4990b1a7c5
<form id="hsForm_5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" method="POST" accept-charset="UTF-8" enctype="multipart/form-data" novalidate=""
action="https://forms.hsforms.com/submissions/v3/public/submit/formsnext/multipart/541808/5f63f877-be5f-4e58-9005-ad4990b1a7c5"
class="hs-form-private hsForm_5f63f877-be5f-4e58-9005-ad4990b1a7c5 hs-form-5f63f877-be5f-4e58-9005-ad4990b1a7c5 hs-form-5f63f877-be5f-4e58-9005-ad4990b1a7c5_20e08dde-d9bd-4fb3-b91b-f3fe76d2549e hs-form stacked hs-custom-form"
target="target_iframe_5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" data-instance-id="20e08dde-d9bd-4fb3-b91b-f3fe76d2549e" data-form-id="5f63f877-be5f-4e58-9005-ad4990b1a7c5" data-portal-id="541808"
data-test-id="hsForm_5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367">
<fieldset class="form-columns-2">
<div class="hs_firstname hs-firstname hs-fieldtype-text field hs-form-field"><label id="label-firstname-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" class="" placeholder="Enter your "
for="firstname-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367"><span></span></label>
<legend class="hs-field-desc" style="display: none;"></legend>
<div class="input" style="align-items: center;"><input id="firstname-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" name="firstname" required="" placeholder="First name*" type="text" class="hs-input" inputmode="text" autocomplete="given-name"
value=""><svg viewBox="0 0 24 24" width="20" height="20" style="margin-left: -2rem; pointer-events: none;" class="hs-input__icon" fill="none">
<path d="M6.750 6.000 A5.250 5.250 0 1 0 17.250 6.000 A5.250 5.250 0 1 0 6.750 6.000 Z" fill="none" stroke="#000000" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M2.25,23.25a9.75,9.75,0,0,1,19.5,0" fill="none" stroke="#000000" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></div>
</div>
<div class="hs_lastname hs-lastname hs-fieldtype-text field hs-form-field"><label id="label-lastname-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" class="" placeholder="Enter your "
for="lastname-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367"><span></span></label>
<legend class="hs-field-desc" style="display: none;"></legend>
<div class="input" style="align-items: center;"><input id="lastname-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" name="lastname" required="" placeholder="Last name*" type="text" class="hs-input" inputmode="text" autocomplete="family-name"
value=""><svg viewBox="0 0 24 24" width="20" height="20" style="margin-left: -2rem; pointer-events: none;" class="hs-input__icon" fill="none">
<path d="M6.750 6.000 A5.250 5.250 0 1 0 17.250 6.000 A5.250 5.250 0 1 0 6.750 6.000 Z" fill="none" stroke="#000000" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M2.25,23.25a9.75,9.75,0,0,1,19.5,0" fill="none" stroke="#000000" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></div>
</div>
</fieldset>
<fieldset class="form-columns-2">
<div class="hs_email hs-email hs-fieldtype-text field hs-form-field"><label id="label-email-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" class="" placeholder="Enter your " for="email-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367"><span></span></label>
<legend class="hs-field-desc" style="display: none;"></legend>
<div class="input" style="align-items: center;"><input id="email-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" name="email" required="" placeholder="Work email*" type="email" class="hs-input" inputmode="email" autocomplete="email" value=""><svg
viewBox="0 0 24 24" width="20" height="20" style="margin-left: -2rem; pointer-events: none;" class="hs-input__icon" fill="none">
<path d="M2.759,15.629a1.664,1.664,0,0,1-.882-3.075L20.36,1A1.663,1.663,0,0,1,22.876,2.72l-3.6,19.173a1.664,1.664,0,0,1-2.966.691L11.1,15.629Z" fill="none" stroke="#000000" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M11.1,15.629H8.6V20.8a1.663,1.663,0,0,0,2.6,1.374l3.178-2.166Z" fill="none" stroke="#000000" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M11.099 15.629L22.179 1.039" fill="none" stroke="#000000" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></div>
</div>
<div class="hs_phone hs-phone hs-fieldtype-phonenumber field hs-form-field"><label id="label-phone-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" class="" placeholder="Enter your "
for="phone-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367"><span></span></label>
<legend class="hs-field-desc" style="display: none;"></legend>
<div class="input" style="align-items: center;">
<div class="hs-input hs-fieldtype-intl-phone"><select id="phone_ext-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" required="" class="hs-input" name="">
<option disabled="" value="" data-full-text="*"></option>
<option value="AF" data-full-text="Afghanistan (افغانستان)">AF</option>
<option value="AL" data-full-text="Albania (Shqipëri)">AL</option>
<option value="DZ" data-full-text="Algeria (الجزائر)">DZ</option>
<option value="AS" data-full-text="American Samoa">AS</option>
<option value="AD" data-full-text="Andorra">AD</option>
<option value="AO" data-full-text="Angola">AO</option>
<option value="AI" data-full-text="Anguilla">AI</option>
<option value="AG" data-full-text="Antigua and Barbuda">AG</option>
<option value="AR" data-full-text="Argentina">AR</option>
<option value="AM" data-full-text="Armenia (Հայաստան)">AM</option>
<option value="AW" data-full-text="Aruba">AW</option>
<option value="AU" data-full-text="Australia">AU</option>
<option value="AT" data-full-text="Austria (Österreich)">AT</option>
<option value="AZ" data-full-text="Azerbaijan (Azərbaycan)">AZ</option>
<option value="BS" data-full-text="Bahamas">BS</option>
<option value="BH" data-full-text="Bahrain (البحرين)">BH</option>
<option value="BD" data-full-text="Bangladesh (বাংলাদেশ)">BD</option>
<option value="BB" data-full-text="Barbados">BB</option>
<option value="BY" data-full-text="Belarus (Беларусь)">BY</option>
<option value="BE" data-full-text="Belgium (België)">BE</option>
<option value="BZ" data-full-text="Belize">BZ</option>
<option value="BJ" data-full-text="Benin (Bénin)">BJ</option>
<option value="BM" data-full-text="Bermuda">BM</option>
<option value="BT" data-full-text="Bhutan (འབྲུག)">BT</option>
<option value="BO" data-full-text="Bolivia">BO</option>
<option value="BA" data-full-text="Bosnia and Herzegovina (Босна и Херцеговина)">BA</option>
<option value="BW" data-full-text="Botswana">BW</option>
<option value="BR" data-full-text="Brazil (Brasil)">BR</option>
<option value="IO" data-full-text="British Indian Ocean Territory">IO</option>
<option value="VG" data-full-text="British Virgin Islands">VG</option>
<option value="BN" data-full-text="Brunei">BN</option>
<option value="BG" data-full-text="Bulgaria (България)">BG</option>
<option value="BF" data-full-text="Burkina Faso">BF</option>
<option value="BI" data-full-text="Burundi (Uburundi)">BI</option>
<option value="KH" data-full-text="Cambodia (កម្ពុជា)">KH</option>
<option value="CM" data-full-text="Cameroon (Cameroun)">CM</option>
<option value="CA" data-full-text="Canada">CA</option>
<option value="CV" data-full-text="Cape Verde (Kabu Verdi)">CV</option>
<option value="BQ" data-full-text="Caribbean Netherlands">BQ</option>
<option value="KY" data-full-text="Cayman Islands">KY</option>
<option value="CF" data-full-text="Central African Republic (République centrafricaine)">CF</option>
<option value="TD" data-full-text="Chad (Tchad)">TD</option>
<option value="CL" data-full-text="Chile">CL</option>
<option value="CN" data-full-text="China (中国)">CN</option>
<option value="CO" data-full-text="Colombia">CO</option>
<option value="KM" data-full-text="Comoros (جزر القمر)">KM</option>
<option value="CD" data-full-text="Congo (DRC) (Jamhuri ya Kidemokrasia ya Kongo)">CD</option>
<option value="CG" data-full-text="Congo (Republic) (Congo-Brazzaville)">CG</option>
<option value="CK" data-full-text="Cook Islands">CK</option>
<option value="CR" data-full-text="Costa Rica">CR</option>
<option value="CI" data-full-text="Côte d’Ivoire">CI</option>
<option value="HR" data-full-text="Croatia (Hrvatska)">HR</option>
<option value="CU" data-full-text="Cuba">CU</option>
<option value="CW" data-full-text="Curaçao">CW</option>
<option value="CY" data-full-text="Cyprus (Κύπρος)">CY</option>
<option value="CZ" data-full-text="Czech Republic (Česká republika)">CZ</option>
<option value="DK" data-full-text="Denmark (Danmark)">DK</option>
<option value="DJ" data-full-text="Djibouti">DJ</option>
<option value="DM" data-full-text="Dominica">DM</option>
<option value="DO" data-full-text="Dominican Republic (República Dominicana)">DO</option>
<option value="EC" data-full-text="Ecuador">EC</option>
<option value="EG" data-full-text="Egypt (مصر)">EG</option>
<option value="SV" data-full-text="El Salvador">SV</option>
<option value="GQ" data-full-text="Equatorial Guinea (Guinea Ecuatorial)">GQ</option>
<option value="ER" data-full-text="Eritrea">ER</option>
<option value="EE" data-full-text="Estonia (Eesti)">EE</option>
<option value="ET" data-full-text="Ethiopia">ET</option>
<option value="FK" data-full-text="Falkland Islands (Islas Malvinas)">FK</option>
<option value="FO" data-full-text="Faroe Islands (Føroyar)">FO</option>
<option value="FJ" data-full-text="Fiji">FJ</option>
<option value="FI" data-full-text="Finland (Suomi)">FI</option>
<option value="FR" data-full-text="France">FR</option>
<option value="GF" data-full-text="French Guiana (Guyane française)">GF</option>
<option value="PF" data-full-text="French Polynesia (Polynésie française)">PF</option>
<option value="GA" data-full-text="Gabon">GA</option>
<option value="GM" data-full-text="Gambia">GM</option>
<option value="GE" data-full-text="Georgia (საქართველო)">GE</option>
<option value="DE" data-full-text="Germany (Deutschland)">DE</option>
<option value="GH" data-full-text="Ghana (Gaana)">GH</option>
<option value="GI" data-full-text="Gibraltar">GI</option>
<option value="GR" data-full-text="Greece (Ελλάδα)">GR</option>
<option value="GL" data-full-text="Greenland (Kalaallit Nunaat)">GL</option>
<option value="GD" data-full-text="Grenada">GD</option>
<option value="GP" data-full-text="Guadeloupe">GP</option>
<option value="GU" data-full-text="Guam">GU</option>
<option value="GT" data-full-text="Guatemala">GT</option>
<option value="GN" data-full-text="Guinea (Guinée)">GN</option>
<option value="GW" data-full-text="Guinea-Bissau (Guiné Bissau)">GW</option>
<option value="GY" data-full-text="Guyana">GY</option>
<option value="HT" data-full-text="Haiti">HT</option>
<option value="HN" data-full-text="Honduras">HN</option>
<option value="HK" data-full-text="Hong Kong (香港)">HK</option>
<option value="HU" data-full-text="Hungary (Magyarország)">HU</option>
<option value="IS" data-full-text="Iceland (Ísland)">IS</option>
<option value="IN" data-full-text="India (भारत)">IN</option>
<option value="ID" data-full-text="Indonesia">ID</option>
<option value="IR" data-full-text="Iran (ایران)">IR</option>
<option value="IQ" data-full-text="Iraq (العراق)">IQ</option>
<option value="IE" data-full-text="Ireland">IE</option>
<option value="IL" data-full-text="Israel (ישראל)">IL</option>
<option value="IT" data-full-text="Italy (Italia)">IT</option>
<option value="JM" data-full-text="Jamaica">JM</option>
<option value="JP" data-full-text="Japan (日本)">JP</option>
<option value="JO" data-full-text="Jordan (الأردن)">JO</option>
<option value="KZ" data-full-text="Kazakhstan (Казахстан)">KZ</option>
<option value="KE" data-full-text="Kenya">KE</option>
<option value="KI" data-full-text="Kiribati">KI</option>
<option value="XK" data-full-text="Kosovo">XK</option>
<option value="KW" data-full-text="Kuwait (الكويت)">KW</option>
<option value="KG" data-full-text="Kyrgyzstan (Кыргызстан)">KG</option>
<option value="LA" data-full-text="Laos (ລາວ)">LA</option>
<option value="LV" data-full-text="Latvia (Latvija)">LV</option>
<option value="LB" data-full-text="Lebanon (لبنان)">LB</option>
<option value="LS" data-full-text="Lesotho">LS</option>
<option value="LR" data-full-text="Liberia">LR</option>
<option value="LY" data-full-text="Libya (ليبيا)">LY</option>
<option value="LI" data-full-text="Liechtenstein">LI</option>
<option value="LT" data-full-text="Lithuania (Lietuva)">LT</option>
<option value="LU" data-full-text="Luxembourg">LU</option>
<option value="MO" data-full-text="Macau (澳門)">MO</option>
<option value="MK" data-full-text="Macedonia (FYROM) (Македонија)">MK</option>
<option value="MG" data-full-text="Madagascar (Madagasikara)">MG</option>
<option value="MW" data-full-text="Malawi">MW</option>
<option value="MY" data-full-text="Malaysia">MY</option>
<option value="MV" data-full-text="Maldives">MV</option>
<option value="ML" data-full-text="Mali">ML</option>
<option value="MT" data-full-text="Malta">MT</option>
<option value="MH" data-full-text="Marshall Islands">MH</option>
<option value="MQ" data-full-text="Martinique">MQ</option>
<option value="MR" data-full-text="Mauritania (موريتانيا)">MR</option>
<option value="MU" data-full-text="Mauritius (Moris)">MU</option>
<option value="MX" data-full-text="Mexico (México)">MX</option>
<option value="FM" data-full-text="Micronesia">FM</option>
<option value="MD" data-full-text="Moldova (Republica Moldova)">MD</option>
<option value="MC" data-full-text="Monaco">MC</option>
<option value="MN" data-full-text="Mongolia (Монгол)">MN</option>
<option value="ME" data-full-text="Montenegro (Crna Gora)">ME</option>
<option value="MS" data-full-text="Montserrat">MS</option>
<option value="MA" data-full-text="Morocco (المغرب)">MA</option>
<option value="MZ" data-full-text="Mozambique (Moçambique)">MZ</option>
<option value="MM" data-full-text="Myanmar (Burma) (မြန်မာ)">MM</option>
<option value="NA" data-full-text="Namibia (Namibië)">NA</option>
<option value="NR" data-full-text="Nauru">NR</option>
<option value="NP" data-full-text="Nepal (नेपाल)">NP</option>
<option value="NL" data-full-text="Netherlands (Nederland)">NL</option>
<option value="NC" data-full-text="New Caledonia (Nouvelle-Calédonie)">NC</option>
<option value="NZ" data-full-text="New Zealand">NZ</option>
<option value="NI" data-full-text="Nicaragua">NI</option>
<option value="NE" data-full-text="Niger (Nijar)">NE</option>
<option value="NG" data-full-text="Nigeria">NG</option>
<option value="NU" data-full-text="Niue">NU</option>
<option value="NF" data-full-text="Norfolk Island">NF</option>
<option value="KP" data-full-text="North Korea (조선 민주주의 인민 공화국)">KP</option>
<option value="MP" data-full-text="Northern Mariana Islands">MP</option>
<option value="NO" data-full-text="Norway (Norge)">NO</option>
<option value="OM" data-full-text="Oman (عُمان)">OM</option>
<option value="PK" data-full-text="Pakistan (پاکستان)">PK</option>
<option value="PW" data-full-text="Palau">PW</option>
<option value="PS" data-full-text="Palestine (فلسطين)">PS</option>
<option value="PA" data-full-text="Panama (Panamá)">PA</option>
<option value="PG" data-full-text="Papua New Guinea">PG</option>
<option value="PY" data-full-text="Paraguay">PY</option>
<option value="PE" data-full-text="Peru (Perú)">PE</option>
<option value="PH" data-full-text="Philippines">PH</option>
<option value="PL" data-full-text="Poland (Polska)">PL</option>
<option value="PT" data-full-text="Portugal">PT</option>
<option value="PR" data-full-text="Puerto Rico">PR</option>
<option value="QA" data-full-text="Qatar (قطر)">QA</option>
<option value="RE" data-full-text="Réunion (La Réunion)">RE</option>
<option value="RO" data-full-text="Romania (România)">RO</option>
<option value="RU" data-full-text="Russia (Россия)">RU</option>
<option value="RW" data-full-text="Rwanda">RW</option>
<option value="BL" data-full-text="Saint Barthélemy (Saint-Barthélemy)">BL</option>
<option value="SH" data-full-text="Saint Helena">SH</option>
<option value="KN" data-full-text="Saint Kitts and Nevis">KN</option>
<option value="LC" data-full-text="Saint Lucia">LC</option>
<option value="MF" data-full-text="Saint Martin (Saint-Martin (partie française))">MF</option>
<option value="PM" data-full-text="Saint Pierre and Miquelon (Saint-Pierre-et-Miquelon)">PM</option>
<option value="VC" data-full-text="Saint Vincent and the Grenadines">VC</option>
<option value="WS" data-full-text="Samoa">WS</option>
<option value="SM" data-full-text="San Marino">SM</option>
<option value="ST" data-full-text="São Tomé and Príncipe (São Tomé e Príncipe)">ST</option>
<option value="SA" data-full-text="Saudi Arabia (المملكة العربية السعودية)">SA</option>
<option value="SN" data-full-text="Senegal (Sénégal)">SN</option>
<option value="RS" data-full-text="Serbia (Србија)">RS</option>
<option value="SC" data-full-text="Seychelles">SC</option>
<option value="SL" data-full-text="Sierra Leone">SL</option>
<option value="SG" data-full-text="Singapore">SG</option>
<option value="SX" data-full-text="Sint Maarten">SX</option>
<option value="SK" data-full-text="Slovakia (Slovensko)">SK</option>
<option value="SI" data-full-text="Slovenia (Slovenija)">SI</option>
<option value="SB" data-full-text="Solomon Islands">SB</option>
<option value="SO" data-full-text="Somalia (Soomaaliya)">SO</option>
<option value="ZA" data-full-text="South Africa">ZA</option>
<option value="KR" data-full-text="South Korea (대한민국)">KR</option>
<option value="SS" data-full-text="South Sudan (جنوب السودان)">SS</option>
<option value="ES" data-full-text="Spain (España)">ES</option>
<option value="LK" data-full-text="Sri Lanka (ශ්රී ලංකාව)">LK</option>
<option value="SD" data-full-text="Sudan (السودان)">SD</option>
<option value="SR" data-full-text="Suriname">SR</option>
<option value="SZ" data-full-text="Swaziland">SZ</option>
<option value="SE" data-full-text="Sweden (Sverige)">SE</option>
<option value="CH" data-full-text="Switzerland (Schweiz)">CH</option>
<option value="SY" data-full-text="Syria (سوريا)">SY</option>
<option value="TW" data-full-text="Taiwan (台灣)">TW</option>
<option value="TJ" data-full-text="Tajikistan">TJ</option>
<option value="TZ" data-full-text="Tanzania">TZ</option>
<option value="TH" data-full-text="Thailand (ไทย)">TH</option>
<option value="TL" data-full-text="Timor-Leste">TL</option>
<option value="TG" data-full-text="Togo">TG</option>
<option value="TK" data-full-text="Tokelau">TK</option>
<option value="TO" data-full-text="Tonga">TO</option>
<option value="TT" data-full-text="Trinidad and Tobago">TT</option>
<option value="TN" data-full-text="Tunisia (تونس)">TN</option>
<option value="TR" data-full-text="Turkey (Türkiye)">TR</option>
<option value="TM" data-full-text="Turkmenistan">TM</option>
<option value="TC" data-full-text="Turks and Caicos Islands">TC</option>
<option value="TV" data-full-text="Tuvalu">TV</option>
<option value="VI" data-full-text="U.S. Virgin Islands">VI</option>
<option value="UG" data-full-text="Uganda">UG</option>
<option value="UA" data-full-text="Ukraine (Україна)">UA</option>
<option value="AE" data-full-text="United Arab Emirates (الإمارات العربية المتحدة)">AE</option>
<option value="GB" data-full-text="United Kingdom">GB</option>
<option value="US" data-full-text="United States">US</option>
<option value="UY" data-full-text="Uruguay">UY</option>
<option value="UZ" data-full-text="Uzbekistan (Oʻzbekiston)">UZ</option>
<option value="VU" data-full-text="Vanuatu">VU</option>
<option value="VA" data-full-text="Vatican City (Città del Vaticano)">VA</option>
<option value="VE" data-full-text="Venezuela">VE</option>
<option value="VN" data-full-text="Vietnam (Việt Nam)">VN</option>
<option value="WF" data-full-text="Wallis and Futuna">WF</option>
<option value="YE" data-full-text="Yemen (اليمن)">YE</option>
<option value="ZM" data-full-text="Zambia">ZM</option>
<option value="ZW" data-full-text="Zimbabwe">ZW</option>
</select><input id="phone-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" name="" required="" placeholder="Phone number*" type="tel" class="hs-input" inputmode="tel" autocomplete="tel" value="+49 "><input name="phone" class="hs-input"
type="hidden" value=""></div><svg viewBox="0 0 24 24" width="20" height="20" style="margin-left: -2rem; pointer-events: none;" class="hs-input__icon" fill="none">
<path
d="M12.37,22.54l.01.007a4.5,4.5,0,0,0,5.6-.615l.629-.629a1.5,1.5,0,0,0,0-2.122L15.956,16.53a1.5,1.5,0,0,0-2.122,0h0a1.5,1.5,0,0,1-2.121,0L7.471,12.287a1.5,1.5,0,0,1,0-2.121h0a1.5,1.5,0,0,0,0-2.122L4.819,5.393a1.5,1.5,0,0,0-2.121,0l-.63.629a4.5,4.5,0,0,0-.614,5.6l.006.01A40.606,40.606,0,0,0,12.37,22.54Z"
fill="none" stroke="#000000" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M11.25,8.25a4.5,4.5,0,0,1,4.5,4.5" fill="none" stroke="#000000" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M11.25,4.5a8.25,8.25,0,0,1,8.25,8.25" fill="none" stroke="#000000" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M11.25.75a12,12,0,0,1,12,12" fill="none" stroke="#000000" stroke-linecap="round" stroke-linejoin="round"></path>
</svg>
</div>
</div>
</fieldset>
<fieldset class="form-columns-2">
<div class="hs_how_many_sales_reps_do_you_have_in_your_organization_ hs-how_many_sales_reps_do_you_have_in_your_organization_ hs-fieldtype-select field hs-form-field"><label
id="label-how_many_sales_reps_do_you_have_in_your_organization_-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" class="" placeholder="Enter your "
for="how_many_sales_reps_do_you_have_in_your_organization_-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367"><span></span></label>
<legend class="hs-field-desc" style="display: none;"></legend>
<div class="input" style="align-items: center;"><select id="how_many_sales_reps_do_you_have_in_your_organization_-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" required="" class="hs-input is-placeholder"
name="how_many_sales_reps_do_you_have_in_your_organization_">
<option disabled="" value="">Sales team size*</option>
<option value="1-4">1-4</option>
<option value="5-9">5-9</option>
<option value="10-49">10-49</option>
<option value="50-249">50-249</option>
<option value="250+">250+</option>
</select><svg viewBox="0 0 24 24" width="20" height="20" style="margin-left: -2rem; pointer-events: none;" class="hs-input__icon" fill="none">
<path stroke="#000000" stroke-linecap="round" stroke-linejoin="round"
d="M23.25 7.311L12.53 18.03C12.4604 18.0997 12.3778 18.1549 12.2869 18.1926C12.1959 18.2304 12.0984 18.2498 12 18.2498C11.9016 18.2498 11.8041 18.2304 11.7131 18.1926C11.6222 18.1549 11.5396 18.0997 11.47 18.03L0.75 7.311"></path>
</svg></div>
</div>
<div class="hs_crm hs-crm hs-fieldtype-select field hs-form-field"><label id="label-crm-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" class="" placeholder="Enter your " for="crm-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367"><span></span></label>
<legend class="hs-field-desc" style="display: none;"></legend>
<div class="input" style="align-items: center;"><select id="crm-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" required="" class="hs-input is-placeholder" name="crm">
<option disabled="" value="">Current CRM*</option>
<option value="Salesforce">Salesforce</option>
<option value="Pipedrive">Pipedrive</option>
<option value="HubSpot CRM">HubSpot CRM</option>
<option value="Superoffice">SuperOffice</option>
<option value="Microsoft Dynamics CRM">Microsoft Dynamics CRM </option>
<option value="Lime CRM">Lime CRM </option>
<option value="Other">Other</option>
<option value="None">None</option>
</select><svg viewBox="0 0 24 24" width="20" height="20" style="margin-left: -2rem; pointer-events: none;" class="hs-input__icon" fill="none">
<path stroke="#000000" stroke-linecap="round" stroke-linejoin="round"
d="M23.25 7.311L12.53 18.03C12.4604 18.0997 12.3778 18.1549 12.2869 18.1926C12.1959 18.2304 12.0984 18.2498 12 18.2498C11.9016 18.2498 11.8041 18.2304 11.7131 18.1926C11.6222 18.1549 11.5396 18.0997 11.47 18.03L0.75 7.311"></path>
</svg></div>
</div>
</fieldset>
<fieldset class="form-columns-1 js-hidden-field">
<div class="hs_utm_campaign hs-utm_campaign hs-fieldtype-text field hs-form-field" style="display: none;"><label id="label-utm_campaign-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" class="" placeholder="Enter your utm_campaign"
for="utm_campaign-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367"><span>utm_campaign</span></label>
<legend class="hs-field-desc" style="display: none;"></legend>
<div class="input" style="align-items: center;"><input name="utm_campaign" class="hs-input" type="hidden" value=""></div>
</div>
</fieldset>
<fieldset class="form-columns-1 js-hidden-field">
<div class="hs_utm_content hs-utm_content hs-fieldtype-text field hs-form-field" style="display: none;"><label id="label-utm_content-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" class="" placeholder="Enter your utm_content"
for="utm_content-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367"><span>utm_content</span></label>
<legend class="hs-field-desc" style="display: none;"></legend>
<div class="input" style="align-items: center;"><input name="utm_content" class="hs-input" type="hidden" value=""></div>
</div>
</fieldset>
<fieldset class="form-columns-1 js-hidden-field">
<div class="hs_utm_medium hs-utm_medium hs-fieldtype-text field hs-form-field" style="display: none;"><label id="label-utm_medium-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" class="" placeholder="Enter your utm_medium"
for="utm_medium-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367"><span>utm_medium</span></label>
<legend class="hs-field-desc" style="display: none;"></legend>
<div class="input" style="align-items: center;"><input name="utm_medium" class="hs-input" type="hidden" value=""></div>
</div>
</fieldset>
<fieldset class="form-columns-1 js-hidden-field">
<div class="hs_utm_source hs-utm_source hs-fieldtype-text field hs-form-field" style="display: none;"><label id="label-utm_source-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" class="" placeholder="Enter your utm_source"
for="utm_source-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367"><span>utm_source</span></label>
<legend class="hs-field-desc" style="display: none;"></legend>
<div class="input" style="align-items: center;"><input name="utm_source" class="hs-input" type="hidden" value=""></div>
</div>
</fieldset>
<fieldset class="form-columns-1 js-hidden-field">
<div class="hs_utm_term hs-utm_term hs-fieldtype-text field hs-form-field" style="display: none;"><label id="label-utm_term-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" class="" placeholder="Enter your utm_term"
for="utm_term-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367"><span>utm_term</span></label>
<legend class="hs-field-desc" style="display: none;"></legend>
<div class="input" style="align-items: center;"><input name="utm_term" class="hs-input" type="hidden" value=""></div>
</div>
</fieldset>
<fieldset class="form-columns-1 js-hidden-field">
<div class="hs_gclid hs-gclid hs-fieldtype-text field hs-form-field smart-field" style="display: none;"><label id="label-gclid-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" class="" placeholder="Enter your Original Google ad click ID"
for="gclid-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367"><span>Original Google ad click ID</span></label>
<legend class="hs-field-desc" style="display: none;"></legend>
<div class="input" style="align-items: center;"><input name="gclid" class="hs-input" type="hidden" value=""></div>
</div>
</fieldset>
<fieldset class="form-columns-1 js-hidden-field">
<div class="hs_traffic_channel hs-traffic_channel hs-fieldtype-text field hs-form-field smart-field" style="display: none;"><label id="label-traffic_channel-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" class=""
placeholder="Enter your Traffic Channel" for="traffic_channel-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367"><span>Traffic Channel</span></label>
<legend class="hs-field-desc" style="display: none;"></legend>
<div class="input" style="align-items: center;"><input name="traffic_channel" class="hs-input" type="hidden" value="Direct Traffic"></div>
</div>
</fieldset>
<fieldset class="form-columns-1 js-hidden-field">
<div class="hs_mql___converting_page hs-mql___converting_page hs-fieldtype-text field hs-form-field smart-field" style="display: none;"><label id="label-mql___converting_page-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" class=""
placeholder="Enter your MQL - Demo - Converting Page" for="mql___converting_page-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367"><span>MQL - Demo - Converting Page</span></label>
<legend class="hs-field-desc" style="display: none;"></legend>
<div class="input" style="align-items: center;"><input name="mql___converting_page" class="hs-input" type="hidden" value="https://www.getaccept.com/"></div>
</div>
</fieldset>
<fieldset class="form-columns-1 js-hidden-field">
<div class="hs_mql___referral_page hs-mql___referral_page hs-fieldtype-text field hs-form-field smart-field" style="display: none;"><label id="label-mql___referral_page-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" class=""
placeholder="Enter your MQL - Demo - Referral Page" for="mql___referral_page-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367"><span>MQL - Demo - Referral Page</span></label>
<legend class="hs-field-desc" style="display: none;"></legend>
<div class="input" style="align-items: center;"><input name="mql___referral_page" class="hs-input" type="hidden" value=""></div>
</div>
</fieldset>
<fieldset class="form-columns-1 js-hidden-field">
<div class="hs_partner_registration_source hs-partner_registration_source hs-fieldtype-text field hs-form-field" style="display: none;"><label id="label-partner_registration_source-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" class=""
placeholder="Enter your Partner Registration Source" for="partner_registration_source-5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367"><span>Partner Registration Source</span></label>
<legend class="hs-field-desc" style="display: none;"></legend>
<div class="input" style="align-items: center;"><input name="partner_registration_source" class="hs-input" type="hidden" value=""></div>
</div>
</fieldset>
<fieldset class="form-columns-1">
<div class="legal-consent-container">
<div class="hs-richtext">
<p>By submitting this form I agree to the <a href="https://www.getaccept.com/privacy-policy" rel="noopener">Privacy policy.</a></p>
</div>
</div>
</fieldset>
<div class="hs_submit hs-submit">
<div class="hs-field-desc" style="display: none;"></div>
<div class="actions"><input type="submit" class="hs-button primary large" value="Book a demo"></div>
</div><input name="hs_context" type="hidden"
value="{"embedAtTimestamp":"1705607010776","formDefinitionUpdatedAt":"1700128434248","lang":"en","legalConsentOptions":"{\"legitimateInterestSubscriptionTypes\":[1309038],\"communicationConsentCheckboxes\":[{\"communicationTypeId\":1309038,\"label\":\"<p>By submitting this form I agree to the <a href=\\\"https://www.getaccept.com/privacy-policy\\\" rel=\\\"noopener\\\">privacy policy.</a></p>\",\"required\":true}],\"legitimateInterestLegalBasis\":\"LEGITIMATE_INTEREST_PQL\",\"communicationConsentText\":\"<p>GetAccept is committed to protecting and respecting your privacy, and we’ll only use your personal information to administer your account and to provide the products and services you requested from us. From time to time, we would like to contact you about our products and services, as well as other content that may be of interest to you. If you consent to us contacting you for this purpose, please tick below to say how you would like us to contact you:</p>\",\"processingConsentType\":\"IMPLICIT\",\"processingConsentText\":\"<p>In order to provide you the content requested, we need to store and process your personal data. If you consent to us storing your personal data for this purpose, please tick the checkbox below.</p>\",\"processingConsentCheckboxLabel\":\"<p>I agree to allow GetAccept to store and process my personal data.</p>\",\"privacyPolicyText\":\"<p>By submitting this form I agree to the <a href=\\\"https://www.getaccept.com/privacy-policy\\\" rel=\\\"noopener\\\">Privacy policy.</a></p>\",\"isLegitimateInterest\":true}","clonedFromForm":"a02104d2-23b2-4af4-a1e2-8a613ae998f2","isLegacyThemeAllowed":"true","userAgent":"Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.224 Safari/537.36","pageTitle":"GetAccept | All-in-one digital sales room platform","pageUrl":"https://www.getaccept.com/","pageId":"131331342853","isHubSpotCmsGeneratedPage":true,"canonicalUrl":"https://www.getaccept.com","contentType":"standard-page","hutk":"6c0e87978a27c2e522865138c227b153","__hsfp":3725600676,"__hssc":"214527176.1.1705607011550","__hstc":"214527176.6c0e87978a27c2e522865138c227b153.1705607011550.1705607011550.1705607011550.1","formTarget":"#hs_form_target_form_867987626","formInstanceId":"5367","rawInlineMessage":"<div class=\"thank-you-message-container p-sm flex-col-center text-center gap-sm\">\n<p class=\"label-medium text-center\">Thank you for your demo request!</p>\n<img src=\"https://www.getaccept.com/hubfs/rocket.9dd70460.gif\" alt=\"Rocket ship\" style=\"width: 100px; mix-blend-mode: multiply;\">\n<p class=\"paragraph-medium text-center\">We will get back to you shortly.</p>\n</div>","hsFormKey":"22f29e36c8c25caef3999e8d36a0336c","abTestId":69720094213,"pageName":"GetAccept | All-in-one digital sales room platform","rumScriptExecuteTime":853.1000003814697,"rumTotalRequestTime":1075.9000005722046,"rumTotalRenderTime":1111.4000005722046,"rumServiceResponseTime":222.80000019073486,"rumFormRenderTime":35.5,"connectionType":"4g","firstContentfulPaint":0,"largestContentfulPaint":0,"locale":"en","timestamp":1705607011578,"originalEmbedContext":{"portalId":"541808","formId":"5f63f877-be5f-4e58-9005-ad4990b1a7c5","region":"na1","target":"#hs_form_target_form_867987626","isBuilder":false,"isTestPage":false,"isPreview":false,"formInstanceId":"5367","formsBaseUrl":"/_hcms/forms","css":"","inlineMessage":"<div class=\"thank-you-message-container p-sm flex-col-center text-center gap-sm\">\n<p class=\"label-medium text-center\">Thank you for your demo request!</p>\n<img src=\"https://www.getaccept.com/hubfs/rocket.9dd70460.gif\" alt=\"Rocket ship\" style=\"width: 100px; mix-blend-mode: multiply;\">\n<p class=\"paragraph-medium text-center\">We will get back to you shortly.</p>\n</div>","isMobileResponsive":true,"rawInlineMessage":"<div class=\"thank-you-message-container p-sm flex-col-center text-center gap-sm\">\n<p class=\"label-medium text-center\">Thank you for your demo request!</p>\n<img src=\"https://www.getaccept.com/hubfs/rocket.9dd70460.gif\" alt=\"Rocket ship\" style=\"width: 100px; mix-blend-mode: multiply;\">\n<p class=\"paragraph-medium text-center\">We will get back to you shortly.</p>\n</div>","hsFormKey":"22f29e36c8c25caef3999e8d36a0336c","abTestId":69720094213,"pageName":"GetAccept | All-in-one digital sales room platform","pageId":"131331342853","contentType":"standard-page","formData":{"cssClass":"hs-form stacked hs-custom-form"},"isCMSModuleEmbed":true},"correlationId":"20e08dde-d9bd-4fb3-b91b-f3fe76d2549e","renderedFieldsIds":["firstname","lastname","email","phone","how_many_sales_reps_do_you_have_in_your_organization_","crm","utm_campaign","utm_content","utm_medium","utm_source","utm_term","gclid","traffic_channel","mql___converting_page","mql___referral_page","partner_registration_source"],"captchaStatus":"NOT_APPLICABLE","emailResubscribeStatus":"NOT_APPLICABLE","isInsideCrossOriginFrame":false,"source":"forms-embed-1.4529","sourceName":"forms-embed","sourceVersion":"1.4529","sourceVersionMajor":"1","sourceVersionMinor":"4529","allPageIds":{"embedContextPageId":"131331342853","analyticsPageId":"131331342853","contentPageId":131331342853,"contentAnalyticsPageId":"131331342853"},"_debug_embedLogLines":[{"clientTimestamp":1705607010852,"level":"INFO","message":"Retrieved customer callbacks used on embed context: [\"getExtraMetaDataBeforeSubmit\"]"},{"clientTimestamp":1705607010853,"level":"INFO","message":"Retrieved pageContext values which may be overriden by the embed context: {\"pageTitle\":\"GetAccept | All-in-one digital sales room platform\",\"pageUrl\":\"https://www.getaccept.com/\",\"userAgent\":\"Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.224 Safari/537.36\",\"pageId\":\"131331342853\",\"contentAnalyticsPageId\":\"131331342853\",\"contentPageId\":131331342853,\"isHubSpotCmsGeneratedPage\":true}"},{"clientTimestamp":1705607010854,"level":"INFO","message":"Retrieved countryCode property from normalized embed definition response: \"DE\""},{"clientTimestamp":1705607011573,"level":"INFO","message":"Retrieved analytics values from API response which may be overriden by the embed context: {\"hutk\":\"6c0e87978a27c2e522865138c227b153\",\"canonicalUrl\":\"https://www.getaccept.com\",\"contentType\":\"standard-page\",\"pageId\":\"131331342853\"}"}]}"><iframe
name="target_iframe_5f63f877-be5f-4e58-9005-ad4990b1a7c5_5367" style="display: none;"></iframe>
</form>
POST
<form id="newsletterSignup-footer" accept-charset="UTF-8" method="POST" novalidate="">
<div class="input-container flex-col-start">
<input class="hs-input" data-size="small" type="email" id="email" name="email" placeholder="Email*" required="">
</div>
<input type="submit" value="Subscribe" class="button-small" data-variant="primary">
<div class="legal-consent-container">
<div class="hs-richtext">
<p> By submitting this form I accept the GetAccept <a href="https://www.getaccept.com/privacy-policy" rel="noopener">privacy policy.</a>
</p>
</div>
</div>
</form>
Text Content
Powered by Cookiebot * Consent * Details * [#IABV2SETTINGS#] * About YOUR PRIVACY We use cookies to personalise content and ads, to provide social media features and to analyse our traffic. We also share information about your use of our site with our social media, advertising and analytics partners who may combine it with other information that you’ve provided to them or that they’ve collected from your use of their services. Consent Selection Necessary Preferences Statistics Marketing Show details * Necessary 29 Necessary cookies help make a website usable by enabling basic functions like page navigation and access to secure areas of the website. The website cannot function properly without these cookies. * 26235846.fs1.hubspotusercontent-eu1.net 1 test_cookieUsed to check if the user's browser supports cookies. Expiry: 1 dayType: HTTP * Cookiebot 2 Learn more about this provider 1.gifUsed to count the number of sessions to the website, necessary for optimizing CMP product delivery. Expiry: SessionType: Pixel CookieConsentStores the user's cookie consent state for the current domain Expiry: 1 yearType: HTTP * Google 5 Learn more about this provider _GRECAPTCHAThis cookie is used to distinguish between humans and bots. This is beneficial for the website, in order to make valid reports on the use of their website. Expiry: 180 daysType: HTTP rc::aThis cookie is used to distinguish between humans and bots. This is beneficial for the website, in order to make valid reports on the use of their website. Expiry: PersistentType: HTML rc::bThis cookie is used to distinguish between humans and bots. Expiry: SessionType: HTML rc::cThis cookie is used to distinguish between humans and bots. Expiry: SessionType: HTML rc::fThis cookie is used to distinguish between humans and bots. Expiry: PersistentType: HTML * Intercom 1 Learn more about this provider intercom.played-notificationsUsed by the website to determine which support notifications the user has been shown. Expiry: SessionType: HTML * LinkedIn 3 Learn more about this provider li_gcStores the user's cookie consent state for the current domain Expiry: 180 daysType: HTTP bscookieThis cookie is used to identify the visitor through an application. This allows the visitor to login to a website through their LinkedIn application for example. Expiry: 1 yearType: HTTP JSESSIONIDPreserves users states across page requests. Expiry: SessionType: HTTP * YouTube 2 Learn more about this provider CONSENTUsed to detect if the visitor has accepted the marketing category in the cookie banner. This cookie is necessary for GDPR-compliance of the website. Expiry: 2 yearsType: HTTP SIDPreserves users states across page requests. Expiry: SessionType: HTTP * g2.com g2crowd.com hubspot.com www.getaccept.com zoominfo.com 6 __cf_bm [x6]This cookie is used to distinguish between humans and bots. This is beneficial for the website, in order to make valid reports on the use of their website. Expiry: 1 dayType: HTTP * hubspot.com zoominfo.com 2 _cfuvid [x2]This cookie is a part of the services provided by Cloudflare - Including load-balancing, deliverance of website content and serving DNS connection for website operators. Expiry: SessionType: HTTP * widget.sndcdn.com 1 sc_anonymous_idUsed in context with the 3D-view-function on the website. Expiry: 10 yearsType: HTTP * www.g2.com 2 AWSALBRegisters which server-cluster is serving the visitor. This is used in context with load balancing, in order to optimize user experience. Expiry: 7 daysType: HTTP AWSALBCORSRegisters which server-cluster is serving the visitor. This is used in context with load balancing, in order to optimize user experience. Expiry: 7 daysType: HTTP * www.getaccept.com 4 __cfruidThis cookie is a part of the services provided by Cloudflare - Including load-balancing, deliverance of website content and serving DNS connection for website operators. Expiry: SessionType: HTTP pagesViewedPending Expiry: SessionType: HTML trafficChannelPending Expiry: SessionType: HTML utmDataPending Expiry: SessionType: HTML * Preferences 8 Preference cookies enable a website to remember information that changes the way the website behaves or looks, like your preferred language or the region that you are in. * Intercom 3 Learn more about this provider intercom-device-id-#Sets a specific ID for the user which ensures the integrity of the website’s chat function. Expiry: 270 daysType: HTTP intercom-id-#Allows the website to recoqnise the visitor, in order to optimize the chat-box functionality. Expiry: 270 daysType: HTTP intercom-session-#Sets a specific ID for the user which ensures the integrity of the website’s chat function. Expiry: 7 daysType: HTTP * LinkedIn 2 Learn more about this provider langNecessary for maintaining language-settings across subpages on the website. Expiry: SessionType: HTTP li_alertsUsed to determine when and where certain pop-ups on the website should be presented for the user and remember whether the user has closed these, to keep them from showing multiple times. Expiry: 1 yearType: HTTP * Tenor 1 Learn more about this provider countryCodeThis cookie is used to determine the preferred country setting selected by the visitor. Expiry: SessionType: HTTP * www.getaccept.com js.intercomcdn.com 2 intercom.intercom-state-# [x2]Remembers whether the user has minimized or closed chat-box or pop-up messages on the website. Expiry: PersistentType: HTML * Statistics 28 Statistic cookies help website owners to understand how visitors interact with websites by collecting and reporting information anonymously. * Google 9 Learn more about this provider _ga [x3]Registers a unique ID that is used to generate statistical data on how the visitor uses the website. Expiry: 2 yearsType: HTTP _ga_# [x2]Used by Google Analytics to collect data on the number of times a user has visited the website as well as dates for the first and most recent visit. Expiry: 2 yearsType: HTTP _gatUsed by Google Analytics to throttle request rate Expiry: 1 dayType: HTTP _gid [x2]Registers a unique ID that is used to generate statistical data on how the visitor uses the website. Expiry: 1 dayType: HTTP tdRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: SessionType: Pixel * Hubspot 4 Learn more about this provider __hsscIdentifies if the cookie data needs to be updated in the visitor's browser. Expiry: 1 dayType: HTTP __hssrcUsed to recognise the visitor's browser upon reentry on the website. Expiry: SessionType: HTTP __hstcSets a unique ID for the session. This allows the website to obtain data on visitor behaviour for statistical purposes. Expiry: 180 daysType: HTTP hubspotutkSets a unique ID for the session. This allows the website to obtain data on visitor behaviour for statistical purposes. Expiry: 180 daysType: HTTP * LinkedIn 1 Learn more about this provider AnalyticsSyncHistoryUsed in connection with data-synchronization with third-party analysis service. Expiry: 30 daysType: HTTP * Soundcloud 1 Learn more about this provider number(#)Used to track user’s interaction with embedded content. Expiry: SessionType: HTML * getaccept.storylane.io 11 eidPending Expiry: PersistentType: HTML flv_onleleo5ikycPending Expiry: SessionType: HTML flv_skmybkctjgiuPending Expiry: SessionType: HTML flv_uztj24tmlqkrPending Expiry: SessionType: HTML flv_vrpwenizak7pPending Expiry: SessionType: HTML fp_idPending Expiry: PersistentType: HTML sid_dlbz8i2a9n7xPending Expiry: SessionType: HTML sid_ngapjqj32hfbPending Expiry: SessionType: HTML sid_onleleo5ikycPending Expiry: SessionType: HTML sid_uztj24tmlqkrPending Expiry: SessionType: HTML sid_vrpwenizak7pPending Expiry: SessionType: HTML * www.getaccept.com 2 ziwsSessionCollects statistics on the user's visits to the website, such as the number of visits, average time spent on the website and what pages have been read. Expiry: SessionType: HTML ziwsSessionIdCollects statistics on the user's visits to the website, such as the number of visits, average time spent on the website and what pages have been read. Expiry: SessionType: HTML * Marketing 64 Marketing cookies are used to track visitors across websites. The intention is to display ads that are relevant and engaging for the individual user and thereby more valuable for publishers and third party advertisers. * Meta Platforms, Inc. 3 Learn more about this provider lastExternalReferrerDetects how the user reached the website by registering their last URL-address. Expiry: PersistentType: HTML lastExternalReferrerTimeDetects how the user reached the website by registering their last URL-address. Expiry: PersistentType: HTML _fbpUsed by Facebook to deliver a series of advertisement products such as real time bidding from third party advertisers. Expiry: 3 monthsType: HTTP * G2Crowd 1 Learn more about this provider _session_idStores visitors' navigation by registering landing pages - This allows the website to present relevant products and/or measure their advertisement efficiency on other websites. Expiry: 14 daysType: HTTP * Giphy Support 1 Learn more about this provider giphyPingbackIdUsed to track the visitor's usage of GIFs - This serves for analytical and marketing purposes. Expiry: SessionType: HTML * Google 6 Learn more about this provider IDEUsed by Google DoubleClick to register and report the website user's actions after viewing or clicking one of the advertiser's ads with the purpose of measuring the efficacy of an ad and to present targeted ads to the user. Expiry: 1 yearType: HTTP pagead/landing [x2]Collects data on visitor behaviour from multiple websites, in order to present more relevant advertisement - This also allows the website to limit the number of times that they are shown the same advertisement. Expiry: SessionType: Pixel _gcl_auUsed by Google AdSense for experimenting with advertisement efficiency across websites using their services. Expiry: 3 monthsType: HTTP ads/ga-audiencesUsed by Google AdWords to re-engage visitors that are likely to convert to customers based on the visitor's online behaviour across websites. Expiry: SessionType: Pixel pagead/1p-conversion/#/Pending Expiry: SessionType: Pixel * Hubspot 3 Learn more about this provider __ptq.gifSends data to the marketing platform Hubspot about the visitor's device and behaviour. Tracks the visitor across devices and marketing channels. Expiry: SessionType: Pixel __hmplCollects information on user preferences and/or interaction with web-campaign content - This is used on CRM-campaign-platform used by website owners for promoting events or products. Expiry: PersistentType: HTML HUBLYTICS_EVENTS_53Collects data on visitor behaviour from multiple websites, in order to present more relevant advertisement - This also allows the website to limit the number of times that they are shown the same advertisement. Expiry: PersistentType: HTML * Leadfeeder 1 Learn more about this provider (unnamed)Tracks the individual sessions on the website, allowing the website to compile statistical data from multiple visits. This data can also be used to create leads for marketing purposes. Expiry: SessionType: Pixel * LinkedIn 4 Learn more about this provider bcookieUsed by the social networking service, LinkedIn, for tracking the use of embedded services. Expiry: 1 yearType: HTTP li_sugrCollects data on user behaviour and interaction in order to optimize the website and make advertisement on the website more relevant. Expiry: 3 monthsType: HTTP lidcUsed by the social networking service, LinkedIn, for tracking the use of embedded services. Expiry: 1 dayType: HTTP UserMatchHistoryUsed to track visitors on multiple websites, in order to present relevant advertisement based on the visitor's preferences. Expiry: 30 daysType: HTTP * Microsoft 8 Learn more about this provider _uetsidUsed to track visitors on multiple websites, in order to present relevant advertisement based on the visitor's preferences. Expiry: PersistentType: HTML _uetsid_expContains the expiry-date for the cookie with corresponding name. Expiry: PersistentType: HTML _uetvidUsed to track visitors on multiple websites, in order to present relevant advertisement based on the visitor's preferences. Expiry: PersistentType: HTML _uetvid_expContains the expiry-date for the cookie with corresponding name. Expiry: PersistentType: HTML MSPTCThis cookie registers data on the visitor. The information is used to optimize advertisement relevance. Expiry: 1 yearType: HTTP MUIDUsed widely by Microsoft as a unique user ID. The cookie enables user tracking by synchronising the ID across many Microsoft domains. Expiry: 1 yearType: HTTP _uetsidCollects data on visitor behaviour from multiple websites, in order to present more relevant advertisement - This also allows the website to limit the number of times that they are shown the same advertisement. Expiry: 1 dayType: HTTP _uetvidUsed to track visitors on multiple websites, in order to present relevant advertisement based on the visitor's preferences. Expiry: 1 yearType: HTTP * Soundcloud 1 Learn more about this provider WIDGET::local::assignmentsUsed by audio-platform SoundCloud to implement, measure and improve their embedded content/service on the website - The collection of data also includes visitors’ interaction with embedded content/service. This can be used for statistics or marketing purposes. Expiry: PersistentType: HTML * YouTube 27 Learn more about this provider __Secure-1PAPISIDPending Expiry: SessionType: HTTP __Secure-1PSIDPending Expiry: SessionType: HTTP APISIDPending Expiry: SessionType: HTTP HSIDPending Expiry: SessionType: HTTP LAST_RESULT_ENTRY_KEYUsed to track user’s interaction with embedded content. Expiry: SessionType: HTTP LOGIN_INFOPending Expiry: SessionType: HTTP LogsDatabaseV2:V#||LogsRequestsStorePending Expiry: PersistentType: IDB nextIdUsed to track user’s interaction with embedded content. Expiry: SessionType: HTTP remote_sidNecessary for the implementation and functionality of YouTube video-content on the website. Expiry: SessionType: HTTP requestsUsed to track user’s interaction with embedded content. Expiry: SessionType: HTTP SAPISIDPending Expiry: SessionType: HTTP ServiceWorkerLogsDatabase#SWHealthLogNecessary for the implementation and functionality of YouTube video-content on the website. Expiry: PersistentType: IDB SSIDRegisters a unique ID that is used by Google to keep statistics of how the visitor uses YouTube videos across different websites. Expiry: SessionType: HTTP TESTCOOKIESENABLEDUsed to track user’s interaction with embedded content. Expiry: 1 dayType: HTTP VISITOR_INFO1_LIVETries to estimate the users' bandwidth on pages with integrated YouTube videos. Expiry: 180 daysType: HTTP VISITOR_PRIVACY_METADATAStores the user's cookie consent state for the current domain Expiry: 180 daysType: HTTP YSCRegisters a unique ID to keep statistics of what videos from YouTube the user has seen. Expiry: SessionType: HTTP yt.innertube::nextIdRegisters a unique ID to keep statistics of what videos from YouTube the user has seen. Expiry: PersistentType: HTML ytidb::LAST_RESULT_ENTRY_KEYStores the user's video player preferences using embedded YouTube video Expiry: PersistentType: HTML YtIdbMeta#databasesUsed to track user’s interaction with embedded content. Expiry: PersistentType: IDB yt-remote-cast-availableStores the user's video player preferences using embedded YouTube video Expiry: SessionType: HTML yt-remote-cast-installedStores the user's video player preferences using embedded YouTube video Expiry: SessionType: HTML yt-remote-connected-devicesStores the user's video player preferences using embedded YouTube video Expiry: PersistentType: HTML yt-remote-device-idStores the user's video player preferences using embedded YouTube video Expiry: PersistentType: HTML yt-remote-fast-check-periodStores the user's video player preferences using embedded YouTube video Expiry: SessionType: HTML yt-remote-session-appStores the user's video player preferences using embedded YouTube video Expiry: SessionType: HTML yt-remote-session-nameStores the user's video player preferences using embedded YouTube video Expiry: SessionType: HTML * js.zi-scripts.com 1 _zitokPending Expiry: 1 yearType: HTTP * sc.lfeeder.com 6 _lfa [x2]Used in context with Account-Based-Marketing (ABM). The cookie registers data such as IP-addresses, time spent on the website and page requests for the visit. This is used for retargeting of multiple users rooting from the same IP-addresses. ABM usually facilitates B2B marketing purposes. Expiry: 1 yearType: HTTP _lfa_test_cookie_stored [x2]Used in context with Account-Based-Marketing (ABM). The cookie registers data such as IP-addresses, time spent on the website and page requests for the visit. This is used for retargeting of multiple users rooting from the same IP-addresses. ABM usually facilitates B2B marketing purposes. Expiry: SessionType: HTTP _lfaUsed in context with Account-Based-Marketing (ABM). The cookie registers data such as IP-addresses, time spent on the website and page requests for the visit. This is used for retargeting of multiple users rooting from the same IP-addresses. ABM usually facilitates B2B marketing purposes. Expiry: PersistentType: HTML _lfa_expiryContains the expiry-date for the cookie with corresponding name. Expiry: PersistentType: HTML * www.getaccept.com 2 _ziVisitorInfoPending Expiry: PersistentType: HTML unifiedScriptVerifiedPending Expiry: SessionType: HTML * Unclassified 5 Unclassified cookies are cookies that we are in the process of classifying, together with the providers of individual cookies. * LinkedIn 1 Learn more about this provider sequenceNumber#sequenceNumberPending Expiry: PersistentType: IDB * app.storylane.io 1 sid_btr0t2dqq9quPending Expiry: SessionType: HTML * getaccept.storylane.io 2 sid_ngkodkowk5hfPending Expiry: SessionType: HTML sid_skmybkctjgiuPending Expiry: SessionType: HTML * www.getaccept.com 1 g2DataPending Expiry: SessionType: HTML Cross-domain consent[#BULK_CONSENT_DOMAINS_COUNT#] [#BULK_CONSENT_TITLE#] List of domains your consent applies to: [#BULK_CONSENT_DOMAINS#] Cookie declaration last updated on 18.01.24 by Cookiebot [#IABV2_TITLE#] [#IABV2_BODY_INTRO#] [#IABV2_BODY_LEGITIMATE_INTEREST_INTRO#] [#IABV2_BODY_PREFERENCE_INTRO#] [#IABV2_LABEL_PURPOSES#] [#IABV2_BODY_PURPOSES_INTRO#] [#IABV2_BODY_PURPOSES#] [#IABV2_LABEL_FEATURES#] [#IABV2_BODY_FEATURES_INTRO#] [#IABV2_BODY_FEATURES#] [#IABV2_LABEL_PARTNERS#] [#IABV2_BODY_PARTNERS_INTRO#] [#IABV2_BODY_PARTNERS#] Cookies are small text files that can be used by websites to make a user's experience more efficient. The law states that we can store cookies on your device if they are strictly necessary for the operation of this site. For all other types of cookies we need your permission. This site uses different types of cookies. Some cookies are placed by third party services that appear on our pages. You can at any time change or withdraw your consent from the Cookie Declaration on our website. Learn more about who we are, how you can contact us and how we process personal data in our Privacy Policy. Please state your consent ID and date when you contact us regarding your consent. Do not sell or share my personal information Deny Allow selection Customize Allow all Powered by Cookiebot by Usercentrics Product Digital Sales Room Deal Room Contract Room Product Tour Features * Electronic Signatures * Proposals & Contracts * CPQ - Configure Price Quote * Tracking & Analytics * Sales Content Management * Mutual Action Plan Hot! * All features Integrations & Automations * Salesforce * HubSpot * Microsoft Dynamics * Pipedrive * SuperOffice * 500+ Tools * Open API <> Pricing Why GetAccept Use cases * Account Executives * Sales Operations * Sales Leader * All use cases Industries * IT & Tech * Wholesale & Retail * Profesional Services * All industries Customer Cases * Jeeng * Cheq * Chargebee * All customer cases Resources Customer Community * Product News * Help Center * Frequently Asked Questions Learning Hubs * Digital Sales Room * Electronic Signature Content * The GetAccept Blog * Content Library * Proposal Templates * Events & Webinars * The Sales Ladder Podcast Digital Sales Report 2024 Read report Login Start free trial Book a demo * English * Français * Svenska Book a demo TAKE BACK CONTROL OF YOUR REVENUE 60% of all deals go dark. That's too much lost revenue. Take control and get it back with a digital sales room! Let's talk! Start free trial * * * * * * * * * * * * * * * * * * * * * * * * * * * OUR PROMISE: SEAMLESS SUCCESS * SALES SUCCESS, ON REPEAT Win with ready-to-use proposal templates and smooth sales content management. * NEXT-LEVEL COLLABORATION Engage and manage stakeholders to create a five-star buying experience and close more deals. * IMPROVED WIN RATES Decrease time to close with branded, interactive proposals and secure electronic signatures. OUR DIGITAL SALES ROOM SUPPORTS YOU FROM ‘HELLO’ TO ‘DEAL’ * Seller Create a personalized digital sales room and start adding content Buyer Get one link from first meeting to signed contract 1 IDENTIFY AN OPPORTUNITY * Seller Understand your prospects and identify all stakeholders. Buyer Commit to moving the deal forward via a mutual action plan. 2 FOLLOW UP ON THE DISCOVERY * Seller Build a quote in minutes with CPQ and automate your reminders. Buyer Invite relevant stakeholders to the room to facilitate decision making. 3 BUILD THE PROPOSAL * Seller Edit the proposal after send to avoid emailing different versions. Buyer Chat and request changes, or change quantity yourself. 4 NEGOTIATE THE BEST PRICE * Seller Set a secure signing order for multiple approvers and signers. Buyer Sign the contract from anywhere and at anytime, eIDAS-compliant. 5 CLOSE THE DEAL * TURN PROSPECTS INTO LEADS Book a demo DIGITAL SALES ROOM = DEAL ROOM + CONTRACT ROOM Collaborate seamlessly with a Deal Room or close deals faster with a Contract Room? Choose the right fit for your business, or better yet, combine the power of both! DEAL ROOM One tool, one link, and a five-star buying experience. Upload sales collateral, track performance, create mutual action plans, and live chat with your buyers. A Deal Room makes collaborative wins simple — supporting you from opportunity to proposal. More about the Deal Room CONTRACT ROOM Empower sales reps to become top performers and create stunning quotes and contracts in minutes. Start from scratch with our in-app editor, or use smart templates for interactive, branded contracts. The Contract Room supports you from quote to customer. More about the Contract Room GETACCEPT INTEGRATES WITH YOUR TECH STACK Use the full potential of a digital sales room straight from your CRM, and connect your favorite tools to automate your whole sales process. Find your integration Open API OUR CHAMPIONS OF CHANGE Our customers are at the forefront of sales innovation. Explore their inspiring stories and see how GetAccept became their cornerstone to success. * IN USE Deal Room Contract Room Germain Brion SVP Corporate Strategy “We were looking for a solution to allow us to use videos to engage prospects, send trackable sales materials, forward proposals, and gather signatures on contracts - all within our CRM. GetAccept was the answer.” Talk to our experts By creating and sending their proposals from within their CRM, Chargebee could minimize distractions for the sales team by keeping in their workflow of choice. Read case * IN USE Contract Room Salesforce integration 9X FASTER QUOTING The Revenue Operations Manager only needs to help the reps with proposal revision once out of ten times. Compared to before, it’s a 9x faster quoting process. Talk to our experts SocialTalent was in search of a tool with strong template management, content aggregation, and native integration with Salesforce and Salesforce CPQ. Read case * IN USE Deal Room Salesforce integration Meghan LaMountain Global Sales Enablement Manager "Throughout our process, including a lot of customizations, the team at GetAccept was there to guide us and really went above and beyond to get us up and running." Talk to our experts Cheq’s ideal solution was a digital sales room that helped regional executives maintain data integrity by integrating with their source of truth – Salesforce. Read case * IN USE GetAccept Automations Contract Room -10 HOURS The customer billing information is automatically synced to HubSpot and Chargebee after the contract is signed, removing 10-11 hours of manual work for the sales team. Talk to our experts The SmartPricing team urgently needed a tool to automate manual processes to ensure the company could grow sustainably with the current resources. Read case THE GO-TO PLATFORM FOR REVENUE TEAMS I’M A SALES LEADER Frustrated by fluctuating monthly sales performances? Capture and replicate the success of your top performers and coach your team based on real-time deal insights to hit targets, month after month. Read more I’M A SALES OPERATIONS PROFESSIONAL Losing too many buyers throughout your sales cycle? Put your sellers in control of their deals with a tool that declutters your tech stack and reduces inefficiencies in your sales process to minimize time to close. Read more I’M AN ACCOUNT EXECUTIVE Want to stand out from the competition? Find your sales assets instantly and build a personalized microsite to create a unique experience for each buyer. Understand the true intent of the different stakeholders to move the deal forward. Read more THE GO-TO PLATFORM FOR REVENUE TEAMS I’M A SALES LEADER Frustrated by fluctuating monthly sales performances? Capture and replicate the success of your top performers and coach your team based on real-time deal insights to hit targets, month after month. Read more I’M A SALES OPERATIONS PROFESSIONAL Losing too many buyers throughout your sales cycle? Put your sellers in control of their deals with a tool that declutters your tech stack and reduces inefficiencies in your sales process to minimize time to close. Read more I’M AN ACCOUNT EXECUTIVE Want to stand out from the competition? Find your sales assets instantly and build a personalized microsite to create a unique experience for each buyer. Understand the true intent of the different stakeholders to move the deal forward. Read more HEAR IT FROM THE LEADERS * Tommaso Centonze COO, Smartpricing “We’ve managed to save over 10 hours of admin work per week thanks to the GetAccept Automation between HubSpot and Chargebee." * Gabby Ziolkowska RevOps Manager, SocialTalent "We can honestly say that GetAccept is one of the best products in our revenue tech stack." * Christopher Maricle Executive Director, Head Start CA “GetAccept will be like your first smartphone. You won't know how you lived without it.” LOOKING FOR SOMETHING SPECIFIC? WE’VE GOT YOU COVERED! Explore all features TRACKING & ANALYTICS Gain real-time insights on how prospects interact with your proposals, map new stakeholders when your content is forwarded, and shorten the sales cycle by acting immediately. Explore tracking & analytics SECURE ELECTRONIC SIGNATURES GetAccept makes it easy for your client to sign a contract with an electronic signature. Remove the friction between buyer and seller, get documents signed in real time, and shorten sales cycles by 75%. Explore electronic signature PROPOSALS & CONTRACTS Scale your proposal creation process. GetAccept’s proposal management feature allows you to craft stunning sales proposals and understand which content wins so your reps can shorten their sales cycle. Explore proposals & contracts CPQ - CONFIGURE, PRICE, QUOTE Our CPQ solution empowers sales teams to create and send professional proposals with accurate product quotes and pricing information. In just a few clicks, send pricing tables tailored to a buyer’s specific needs to get deals one step closer to a signature. Explore CPQ MUTUAL ACTION PLANS GetAccept’s mutual action plan function allows you to provide an even better buyer experience and build momentum with prospects. Set an action plan with your buyers to collaboratively understand what needs to be done to close the deal. Explore mutual action plan SALES CONTENT MANAGEMENT Do you feel like you’re losing out because your sales team is not using the latest sales content? Give them a unified and user-friendly content repository to easily find and share the right content at the right time and push buyers down the sales funnel. Empower your sales team START WOWING BUYERS AND HITTING QUOTAS NOW Transform your sales process now Start free trial RELATED ARTICLES * CONTRACT MANAGEMENT SOFTWARE: A COMPLETE GUIDE TO HELP YOU CHOOSE THE RIGHT TOOL FOR YOU Digital Sales / 20 min. * WHAT IS CPQ? THE COMPLETE GUIDE Digital Sales Room / 13 min. * HOW TO CHOOSE THE BEST PROPOSAL SOFTWARE Digital Sales / 10 min. * A COMPLETE GUIDE TO MUTUAL ACTION PLANS (BACKED BY UNIQUE RESEARCH AND EXPERT-DRIVEN INSIGHTS) Mutual Action Plan / 15 min. * WHY REVENUE TEAMS NEED A DIGITAL SALES ROOM Digital Sales Room / 10 min. * 7 BEST PRACTICES FOR USING ELECTRONIC SIGNATURES Electronic Signature / 10 min. * CONTRACT MANAGEMENT SOFTWARE: A COMPLETE GUIDE TO HELP YOU CHOOSE THE RIGHT TOOL FOR YOU Digital Sales / 20 min. * WHAT IS CPQ? THE COMPLETE GUIDE Digital Sales Room / 13 min. * HOW TO CHOOSE THE BEST PROPOSAL SOFTWARE Digital Sales / 10 min. * A COMPLETE GUIDE TO MUTUAL ACTION PLANS (BACKED BY UNIQUE RESEARCH AND EXPERT-DRIVEN INSIGHTS) Mutual Action Plan / 15 min. * WHY REVENUE TEAMS NEED A DIGITAL SALES ROOM Digital Sales Room / 10 min. * 7 BEST PRACTICES FOR USING ELECTRONIC SIGNATURES Electronic Signature / 10 min. * CONTRACT MANAGEMENT SOFTWARE: A COMPLETE GUIDE TO HELP YOU CHOOSE THE RIGHT TOOL FOR YOU Digital Sales / 20 min. * WHAT IS CPQ? THE COMPLETE GUIDE Digital Sales Room / 13 min. * HOW TO CHOOSE THE BEST PROPOSAL SOFTWARE Digital Sales / 10 min. * A COMPLETE GUIDE TO MUTUAL ACTION PLANS (BACKED BY UNIQUE RESEARCH AND EXPERT-DRIVEN INSIGHTS) Mutual Action Plan / 15 min. * WHY REVENUE TEAMS NEED A DIGITAL SALES ROOM Digital Sales Room / 10 min. * 7 BEST PRACTICES FOR USING ELECTRONIC SIGNATURES Electronic Signature / 10 min. SEE GETACCEPT IN ACTION! During your personalized live demo, we’ll show you how to boost your win rates and wow your customers with the best digital sales experience. AFALDZASADAOAIAGARAMAWAUATAZBSBHBDBBBYBEBZBJBMBTBOBABWBRIOVGBNBGBFBIKHCMCACVBQKYCFTDCLCNCOKMCDCGCKCRCIHRCUCWCYCZDKDJDMDOECEGSVGQEREEETFKFOFJFIFRGFPFGAGMGEDEGHGIGRGLGDGPGUGTGNGWGYHTHNHKHUISINIDIRIQIEILITJMJPJOKZKEKIXKKWKGLALVLBLSLRLYLILTLUMOMKMGMWMYMVMLMTMHMQMRMUMXFMMDMCMNMEMSMAMZMMNANRNPNLNCNZNINENGNUNFKPMPNOOMPKPWPSPAPGPYPEPHPLPTPRQARERORURWBLSHKNLCMFPMVCWSSMSTSASNRSSCSLSGSXSKSISBSOZAKRSSESLKSDSRSZSECHSYTWTJTZTHTLTGTKTOTTTNTRTMTCTVVIUGUAAEGBUSUYUZVUVAVEVNWFYEZMZW Sales team size*1-45-910-4950-249250+ Current CRM*SalesforcePipedriveHubSpot CRMSuperOfficeMicrosoft Dynamics CRM Lime CRM OtherNone utm_campaign utm_content utm_medium utm_source utm_term Original Google ad click ID Traffic Channel MQL - Demo - Converting Page MQL - Demo - Referral Page Partner Registration Source By submitting this form I agree to the Privacy policy. +500 Save 500+ hours yearly on admin -75% Cut your sales cycle time by 75% +40% Boost closed deals by 40% Join our newsletter By submitting this form I accept the GetAccept privacy policy. Company * Contact us * Partners * Our story * Careers * Blog * Newsroom Features * Electronic Signatures * Proposals & Contracts * CPQ - Configure Price Quote * Tracking & Analytics * Sales Content Management * Mutual Action Plan Hot! * Notifications & Reminders * Customer Success * Automations * Book a demo Top Integrations * Salesforce * HubSpot * Microsoft Dynamics * Pipedrive * SuperOffice * 500+ more Security Hub * Terms & Conditions * Privacy policy * Security * E-sign & eIDAS 2261 Market Street #4358 San Francisco CA, 94114 US | hello@getaccept.com | +13238701200 | Privacy Policy | Cookie settings | Copyright © 2024 GetAccept Inc. All Rights Reserved.