Submitted URL:
Effective URL:
Submission: On November 23 via manual from NL — Scanned from NL


This website contacted 4 IPs in 1 countries across 3 domains to perform 86 HTTP transactions. The main IP is 2606:4700::6812:1734, located in United States and belongs to CLOUDFLARENET, US. The main domain is The Cisco Umbrella rank of the primary domain is 752349.
TLS certificate: Issued by GTS CA 1P5 on October 16th 2023. Valid for: 3 months.
This is the only time was scanned on! Verdict: No classification

Domain & IP information

IP Address AS Autonomous System
4 87 2606:4700::68... 13335 (CLOUDFLAR...)
1 2606:4700::68... 13335 (CLOUDFLAR...)
1 2606:4700::68... 13335 (CLOUDFLAR...)
86 4
Apex Domain
87 — Cisco Umbrella Rank: 52893 — Cisco Umbrella Rank: 752349
1 MB
1 — Cisco Umbrella Rank: 335
2 KB
1 — Cisco Umbrella Rank: 899
7 KB
86 3
Domain Requested by
84 1 redirects
3 3 redirects
86 4
Subject Issuer Validity Valid
2023-10-16 -
3 months
Cloudflare Inc ECC CA-3
2023-04-10 -
a year

This page contains 2 frames:

Primary Page:
Frame ID: D9074F723BB53AB1B23D1548EEAA78D1
Requests: 88 HTTP requests in this frame

Frame ID: ECF56347E0EEF8FC021760359954A2EC
Requests: 2 HTTP requests in this frame


Page Title

#1 Event Management Software for B2B Conferences | Bizzaboclosearrow-circle-o-downchevron-downtwitterfacebooklinkedinangle-downellipsis-vinstagrammagnifiercrossarrow-defualtplaypause

Page URL History Show full URLs

  1. HTTP 301 HTTP 301 Page URL

Detected technologies

Overall confidence: 100%
Detected patterns
  • /wp-(?:content|includes)/

Overall confidence: 100%
Detected patterns
  • wp-content/plugins/oxygen

Overall confidence: 100%
Detected patterns
  • static\.cloudflareinsights\.com/beacon(?:\.min)?\.js

Overall confidence: 100%
Detected patterns
  • /flickity(?:\.pkgd)?(?:\.min)?\.js

Overall confidence: 100%
Detected patterns
  • jquery.*\.js(?:\?ver(?:sion)?=([\d.]+))?

Overall confidence: 100%
Detected patterns
  • //cdn\.jsdelivr\.net/

Page Statistics


97 %

100 %





1319 kB

3905 kB


Page URL History

This captures the URL locations of the websites, including HTTP redirects and client-side redirects via JavaScript or Meta fields.

  1. HTTP 301 HTTP 301 Page URL

Redirected requests

There were HTTP redirect chains for the following requests:

Request Chain 66
  • HTTP 302
Request Chain 88
  • HTTP 301

86 HTTP transactions

Primary Request /
Redirect Chain
300 KB
49 KB
Full URL
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

h3=":443"; ma=86400
text/html; charset=UTF-8
Thu, 23 Nov 2023 14:42:09 GMT
Thu, 23 Nov 2023 14:42:09 GMT
Thu, 23 Nov 2023 05:00:48 GMT
max-age=31536000; includeSubDomains; preload
Accept-Encoding Accept-Encoding
0 NC:000000 UP:

Redirect headers

h3=":443"; ma=86400
Thu, 23 Nov 2023 14:42:09 GMT
max-age=31536000; includeSubDomains; preload
13 KB
973 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 22 Nov 2023 19:09:09 GMT
Fri, 22 Nov 2024 14:42:10 GMT
107 KB
18 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 09 Nov 2023 11:38:14 GMT
Fri, 22 Nov 2024 14:42:10 GMT
30 KB
7 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 22 Nov 2023 19:09:09 GMT
Fri, 22 Nov 2024 14:42:10 GMT
30 KB
8 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 22 Nov 2023 19:09:09 GMT
Fri, 22 Nov 2024 14:42:10 GMT
17 KB
5 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 22 Nov 2023 19:09:09 GMT
Fri, 22 Nov 2024 14:42:10 GMT
32 KB
7 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 22 Nov 2023 19:09:09 GMT
Fri, 22 Nov 2024 14:42:10 GMT
86 KB
35 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 09 Nov 2023 11:38:14 GMT
Fri, 22 Nov 2024 14:42:10 GMT
117 KB
41 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 18 Oct 2023 11:39:44 GMT
Fri, 22 Nov 2024 14:42:10 GMT
1 KB
607 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 22 Nov 2023 19:09:09 GMT
Fri, 22 Nov 2024 14:42:10 GMT
18 KB
3 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 22 Nov 2023 19:09:09 GMT
Fri, 22 Nov 2024 14:42:10 GMT
54 KB
9 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 22 Nov 2023 19:09:09 GMT
Fri, 22 Nov 2024 14:42:10 GMT
516 B
307 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 22 Nov 2023 19:09:09 GMT
Fri, 22 Nov 2024 14:42:10 GMT
63 KB
10 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 22 Nov 2023 19:09:10 GMT
Fri, 22 Nov 2024 14:42:10 GMT
291 KB
58 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 22 Nov 2023 19:09:09 GMT
Fri, 22 Nov 2024 14:42:10 GMT
64 B
Full URL
-, , ASN (),
Reverse DNS
Resource Hash

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

66 B
Full URL
-, , ASN (),
Reverse DNS
Resource Hash

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

66 B
Full URL
-, , ASN (),
Reverse DNS
Resource Hash

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

25 KB
3 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 22 Nov 2023 19:09:09 GMT
Fri, 22 Nov 2024 14:42:10 GMT
13 KB
5 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 18 Oct 2023 11:39:44 GMT
Fri, 22 Nov 2024 14:42:10 GMT
9 KB
3 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 18 Oct 2023 11:39:44 GMT
Fri, 22 Nov 2024 14:42:10 GMT
20 KB
6 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 18 Oct 2023 11:39:44 GMT
Fri, 22 Nov 2024 14:42:10 GMT
10 KB
3 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 18 Oct 2023 11:39:44 GMT
Fri, 22 Nov 2024 14:42:10 GMT
14 KB
5 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 09 Nov 2023 11:58:02 GMT
Fri, 22 Nov 2024 14:42:10 GMT
51 KB
12 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
14 KB
4 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
27 KB
8 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
12 KB
3 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
13 KB
4 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
53 KB
17 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
29 KB
10 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
11 KB
3 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
1 KB
676 B
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
19 KB
5 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
9 KB
4 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 08 Nov 2023 14:11:23 GMT
Fri, 22 Nov 2024 14:42:10 GMT
20 KB
7 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6810:3865 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:09 GMT
Tue, 10 Oct 2023 21:38:13 GMT
public, max-age=86400
546 B
Full URL
-, , ASN (),
Reverse DNS
Resource Hash

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

604 B
718 B
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 20 Jul 2023 14:09:43 GMT
Fri, 22 Nov 2024 14:42:10 GMT
485 B
618 B
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:10 GMT
Fri, 22 Nov 2024 14:42:10 GMT
29 KB
29 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:11 GMT
max-age=31536000; includeSubDomains; preload
0 NC:000000 UP:
h3=":443"; ma=86400
Accept-Encoding, Accept-Encoding
text/html; charset=UTF-8
no-cache, must-revalidate, max-age=0
<>; rel=""
Wed, 11 Jan 1984 05:00:00 GMT
193 KB
94 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:09 GMT
Fri, 22 Nov 2024 14:42:10 GMT
208 KB
98 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:09 GMT
Fri, 22 Nov 2024 14:42:10 GMT
222 KB
110 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:09 GMT
Fri, 22 Nov 2024 14:42:10 GMT
223 KB
111 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:09 GMT
Fri, 22 Nov 2024 14:42:10 GMT
202 KB
96 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:09 GMT
Fri, 22 Nov 2024 14:42:10 GMT
65 KB
66 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:09 GMT
Fri, 22 Nov 2024 14:42:10 GMT
190 KB
93 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:09 GMT
Fri, 22 Nov 2024 14:42:10 GMT
12 KB
6 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
3 KB
2 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Fri, 02 Dec 2022 13:54:00 GMT
Fri, 22 Nov 2024 14:42:10 GMT
8 KB
4 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Mon, 23 Oct 2023 12:07:18 GMT
Fri, 22 Nov 2024 14:42:10 GMT
3 KB
3 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 20 Jul 2023 14:05:21 GMT
Fri, 22 Nov 2024 14:42:10 GMT
4 KB
2 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 11 Oct 2023 14:28:19 GMT
Fri, 22 Nov 2024 14:42:10 GMT
7 KB
4 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Mon, 23 Oct 2023 12:07:29 GMT
Fri, 22 Nov 2024 14:42:10 GMT
22 KB
22 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 11 Oct 2023 15:19:27 GMT
Fri, 22 Nov 2024 14:42:10 GMT
25 KB
25 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:11 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 03 May 2023 08:25:00 GMT
Fri, 22 Nov 2024 14:42:10 GMT
16 KB
16 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:11 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Tue, 16 May 2023 14:00:46 GMT
Fri, 22 Nov 2024 14:42:10 GMT
32 KB
32 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Tue, 01 Aug 2023 14:22:13 GMT
Fri, 22 Nov 2024 14:42:10 GMT
33 KB
34 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:11 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Tue, 01 Aug 2023 14:36:19 GMT
Fri, 22 Nov 2024 14:42:10 GMT
4 KB
4 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 01 Nov 2023 15:24:55 GMT
Fri, 22 Nov 2024 14:42:10 GMT
836 B
823 B
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 29 Jun 2023 12:42:32 GMT
Fri, 22 Nov 2024 14:42:10 GMT
2 KB
978 B
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 29 Jun 2023 12:42:31 GMT
Fri, 22 Nov 2024 14:42:10 GMT
5 KB
5 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 01 Nov 2023 15:24:59 GMT
Fri, 22 Nov 2024 14:42:10 GMT
5 KB
6 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 01 Nov 2023 15:25:05 GMT
Fri, 22 Nov 2024 14:42:10 GMT
848 B
828 B
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 29 Jun 2023 12:42:30 GMT
Fri, 22 Nov 2024 14:42:10 GMT
11 KB
4 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
42 KB
13 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
43 KB
13 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
main.js Frame ECF5
Redirect Chain
7 KB
4 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
application/javascript; charset=UTF-8
max-age=14400, public
h3=":443"; ma=86400

Redirect headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
max-age=300, public
h3=":443"; ma=86400
2 KB
1 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
848 B
804 B
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
1 KB
1 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
142 B
412 B
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
2 KB
1 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
2 KB
1 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
189 B
462 B
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
819 B
760 B
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
244 B
489 B
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
139 B
420 B
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
245 B
518 B
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
1 KB
912 B
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
181 B
460 B
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:10 GMT
82aa2d57adbab8e5 Frame ECF5

4 KB
2 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6810:5514 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:11 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
cache-fra-eddf8230035-FRA, cache-ams21072-AMS
public, max-age=604800, s-maxage=43200
40 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

identity;q=1, *;q=0
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:11 GMT
max-age=31536000; includeSubDomains; preload
bytes 0-79187943/79187944
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:10 GMT
Fri, 22 Nov 2024 14:42:11 GMT
5 KB
2 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:11 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:11 GMT
661 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

identity;q=1, *;q=0
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:11 GMT
max-age=31536000; includeSubDomains; preload
bytes 196608-79187943/79187944
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:10 GMT
Fri, 22 Nov 2024 14:42:11 GMT
2 KB
1 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:11 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:11 GMT
5 KB
2 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:11 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Fri, 22 Nov 2024 14:42:11 GMT
141 B
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
X-Content-Type-Options nosniff
X-Frame-Options DENY

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Thu, 23 Nov 2023 14:42:11 GMT
Redirect Chain
49 KB
49 KB
Full URL
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers
