Submitted URL: http://appraisalreappraisalstaff.qwkcheckout.com
Effective URL: https://appraisalreappraisalstaff.qwkcheckout.com/
Submission: On November 08 via manual from US

Summary

This website contacted 4 IPs in 2 countries across 4 domains to perform 17 HTTP transactions. The main IP is 209.170.211.179, located in Venice, United States and belongs to ASN-VINS - ViaWest, US. The main domain is appraisalreappraisalstaff.qwkcheckout.com.
TLS certificate: Issued by Let's Encrypt Authority X3 on November 8th 2019. Valid for: 3 months.
This is the only time appraisalreappraisalstaff.qwkcheckout.com was scanned on urlscan.io!

urlscan.io Verdict: No classification

Domain & IP information

IP Address AS Autonomous System
1 3 209.170.211.179 13649 (ASN-VINS)
2 2a00:1450:400... 15169 (GOOGLE)
7 104.16.20.19 13335 (CLOUDFLAR...)
6 2a00:1450:400... 15169 (GOOGLE)
17 4
Domain
Subdomains
Transfer
8 ontraport.com
453 KB
6 gstatic.com
69 KB
2 fonts.googleapis.com
11 KB
2 qwkcheckout.com
14 KB
17 4
Domain Requested by
6 fonts.gstatic.com appraisalreappraisalstaff.qwkcheckout.com
6 optassets.ontraport.com appraisalreappraisalstaff.qwkcheckout.com
2 fonts.googleapis.com appraisalreappraisalstaff.qwkcheckout.com
2 appraisalreappraisalstaff.qwkcheckout.com 1 redirects
1 vcd.ontraport.com optassets.ontraport.com
1 app.ontraport.com optassets.ontraport.com
17 6

This site contains links to these domains. Also see Links.

Domain
Subject / Issuer Validity Valid
appraisalreappraisalstaff.qwkcheckout.com
Let's Encrypt Authority X3
2019-11-08 -
2020-02-06
3 months
*.googleapis.com
GTS CA 1O1
2019-10-16 -
2020-01-08
3 months
*.ontraport.com
Go Daddy Secure Certificate Authority - G2
2019-10-23 -
2020-11-21
a year
*.google.com
GTS CA 1O1
2019-10-16 -
2020-01-08
3 months
vcd.ontraport.com
Let's Encrypt Authority X3
2019-11-08 -
2020-02-06
3 months

Screenshot


Detected technologies

Web
Overall confidence: 100%
Detected patterns
  • html /<link[^>]* href=[^>]+fonts\.(?:googleapis|google)\.com/i


Stats

0
Requests

0
Ad-blocked

0
Malicious

0 %
HTTPS

0 %
IPv6

0
Domains

0
Subdomains

0
IPs

0
Countries

0 kB
Transfer

0 kB
Size

0
Cookies

17 HTTP transactions

Resource
Path
Size
x-fer
Type
MIME-Type
Cookie set /

Redirect Chain
  • http://appraisalreappraisalstaff.qwkcheckout.com/
  • https://appraisalreappraisalstaff.qwkcheckout.com/
71 KB
13 KB
Document
General
Full URL
https://appraisalreappraisalstaff.qwkcheckout.com/
Protocol
HTTP/1.1
Security
TLS 1.2, ECDHE_RSA, AES_128_GCM
Server
209.170.211.179 Venice, United States, ASN13649 (ASN-VINS - ViaWest, US),
Reverse DNS
mail9.ontramail.com
Software
ONTRAport /
Resource Hash
36181ad51326af0782a96f7f9dc1014707b787c5ae5dc023a9de8f16308043b0

Request headers

Host
appraisalreappraisalstaff.qwkcheckout.com
Connection
keep-alive
Pragma
no-cache
Cache-Control
no-cache
Upgrade-Insecure-Requests
1
User-Agent
Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_5) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.70 Safari/537.36
Accept
text/html,application/xhtml+xml,application/xml;q=0.9,image/webp,image/apng,*/*;q=0.8,application/signed-exchange;v=b3
Sec-Fetch-Site
none
Accept-Encoding
gzip, deflate, br
Cookie
secure_redirect=1
Upgrade-Insecure-Requests
1
User-Agent
Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_5) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.70 Safari/537.36

Response headers

Date
Fri, 08 Nov 2019 16:30:29 GMT
Content-Type
text/html; charset=UTF-8
Transfer-Encoding
chunked
Connection
keep-alive
Vary
Accept-Encoding
Set-Cookie
lpsplt_1=0
P3P
CP="IDC DSP COR ADM DEVi TAIi PSA PSD IVAi IVDi CONi HIS OUR IND CNT"
X-op-class
hosted
X-op-release
1
X-op-ca
144.76.109.30
Server
ONTRAport
Access-Control-Allow-Origin
*
Access-Control-Allow-Credentials
true
Access-Control-Allow-Methods
GET, POST, OPTIONS
Content-Encoding
gzip

Redirect headers

Date
Fri, 08 Nov 2019 16:30:28 GMT
Content-Type
text/html
Transfer-Encoding
chunked
Connection
keep-alive
Set-Cookie
secure_redirect=1; expires=Fri, 08-Nov-2019 16:30:29 GMT
location
https://AppraisalReappraisalstaff.qwkcheckout.com
P3P
CP="IDC DSP COR ADM DEVi TAIi PSA PSD IVAi IVDi CONi HIS OUR IND CNT"
X-op-class
hosted
X-op-release
1
X-op-ca
144.76.109.30
Server
ONTRAport
Access-Control-Allow-Origin
*
Access-Control-Allow-Credentials
true
Access-Control-Allow-Methods
GET, POST, OPTIONS
icon?family=Material+Icons
fonts.googleapis.com
574 B
419 B
Stylesheet
General
Full URL
https://fonts.googleapis.com/icon?family=Material+Icons
Requested by
Host: appraisalreappraisalstaff.qwkcheckout.com
URL: https://appraisalreappraisalstaff.qwkcheckout.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2a00:1450:4001:820::200a Frankfurt am Main, Germany, ASN15169 (GOOGLE - Google LLC, US),
Reverse DNS
Software
ESF /
Resource Hash
09e13bc501877a8383c2661e6fc80187efadbd82ac4d3b0d1ec8a41d8630756c
Security Headers
Name Value
Strict-Transport-Security max-age=31536000
X-Frame-Options SAMEORIGIN
X-Xss-Protection 0

Request headers

Sec-Fetch-Mode
no-cors
Referer
https://appraisalreappraisalstaff.qwkcheckout.com/
User-Agent
Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_5) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.70 Safari/537.36

Response headers

strict-transport-security
max-age=31536000
content-encoding
br
last-modified
Fri, 08 Nov 2019 16:30:29 GMT
server
ESF
link
<https://fonts.gstatic.com>; rel=preconnect; crossorigin
status
200
date
Fri, 08 Nov 2019 16:30:29 GMT
x-frame-options
SAMEORIGIN
content-type
text/css; charset=utf-8
access-control-allow-origin
*
cache-control
private, max-age=86400, stale-while-revalidate=604800
timing-allow-origin
*
alt-svc
quic=":443"; ma=2592000; v="46,43",h3-Q050=":443"; ma=2592000,h3-Q049=":443"; ma=2592000,h3-Q048=":443"; ma=2592000,h3-Q046=":443"; ma=2592000,h3-Q043=":443"; ma=2592000
x-xss-protection
0
expires
Fri, 08 Nov 2019 16:30:29 GMT
opt-styles.min.css
optassets.ontraport.com/opt_assets/elements_v3/common/materialize/css
201 KB
33 KB
Stylesheet
General
Full URL
https://optassets.ontraport.com/opt_assets/elements_v3/common/materialize/css/opt-styles.min.css
Requested by
Host: appraisalreappraisalstaff.qwkcheckout.com
URL: https://appraisalreappraisalstaff.qwkcheckout.com/
Protocol
H2
Security
TLS 1.2, ECDHE_RSA, AES_128_GCM
Server
104.16.20.19 , United States, ASN13335 (CLOUDFLARENET - Cloudflare, Inc., US),
Reverse DNS
Software
cloudflare /
Resource Hash
bf2fc030b35e1304c3a4e415eb9487ec464a2c2017ab9a3df02d35a5f2d290b3

Request headers

Sec-Fetch-Mode
no-cors
Referer
https://appraisalreappraisalstaff.qwkcheckout.com/
User-Agent
Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_5) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.70 Safari/537.36

Response headers

date
Fri, 08 Nov 2019 16:30:29 GMT
content-encoding
br
vary
Accept-Encoding
cf-cache-status
HIT
age
4013
p3p
CP="IDC DSP COR ADM DEVi TAIi PSA PSD IVAi IVDi CONi HIS OUR IND CNT"
status
200
x-op-ca
10.2.80.206
server
cloudflare
expect-ct
max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
x-op-release
1
access-control-allow-methods
GET, POST, OPTIONS
content-type
text/css
access-control-allow-origin
*
cache-control
public, max-age=14400
access-control-allow-credentials
true
x-op-class
optassets
cf-ray
5328ee884cf56401-FRA
expires
Fri, 08 Nov 2019 20:30:29 GMT
anime.js
optassets.ontraport.com/opt_assets/elements_v3/common/materialize-1-dev/js
16 KB
16 KB
Script
General
Full URL
https://optassets.ontraport.com/opt_assets/elements_v3/common/materialize-1-dev/js/anime.js
Requested by
Host: appraisalreappraisalstaff.qwkcheckout.com
URL: https://appraisalreappraisalstaff.qwkcheckout.com/
Protocol
H2
Security
TLS 1.2, ECDHE_RSA, AES_128_GCM
Server
104.16.20.19 , United States, ASN13335 (CLOUDFLARENET - Cloudflare, Inc., US),
Reverse DNS
Software
cloudflare /
Resource Hash
2c2348bbc056a14a9cd62dadb8d461800a192e8ba636f803d0ffddd753977976

Request headers

Sec-Fetch-Mode
no-cors
Referer
https://appraisalreappraisalstaff.qwkcheckout.com/
User-Agent
Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_5) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.70 Safari/537.36

Response headers

date
Fri, 08 Nov 2019 16:30:29 GMT
vary
Accept-Encoding
cf-cache-status
HIT
age
3924
p3p
CP="IDC DSP COR ADM DEVi TAIi PSA PSD IVAi IVDi CONi HIS OUR IND CNT"
status
200
x-op-ca
10.2.80.206
server
cloudflare
expect-ct
max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
x-op-release
1
access-control-allow-methods
GET, POST, OPTIONS
access-control-allow-origin
*
cache-control
public, max-age=14400
access-control-allow-credentials
true
x-op-class
optassets
cf-ray
5328ee893e086401-FRA
expires
Fri, 08 Nov 2019 20:30:29 GMT
jquery-3.2.1.min.js
optassets.ontraport.com/opt_assets/opt_boilerplates/v3
85 KB
85 KB
Script
General
Full URL
https://optassets.ontraport.com/opt_assets/opt_boilerplates/v3/jquery-3.2.1.min.js
Requested by
Host: appraisalreappraisalstaff.qwkcheckout.com
URL: https://appraisalreappraisalstaff.qwkcheckout.com/
Protocol
H2
Security
TLS 1.2, ECDHE_RSA, AES_128_GCM
Server
104.16.20.19 , United States, ASN13335 (CLOUDFLARENET - Cloudflare, Inc., US),
Reverse DNS
Software
cloudflare /
Resource Hash
d3a518dea876de39f9e5dc1ffcdeb6c661aee25d8a62474386b664ef3bf1b40f

Request headers

Sec-Fetch-Mode
no-cors
Referer
https://appraisalreappraisalstaff.qwkcheckout.com/
User-Agent
Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_5) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.70 Safari/537.36

Response headers

date
Fri, 08 Nov 2019 16:30:29 GMT
vary
Accept-Encoding
cf-cache-status
HIT
age
3924
p3p
CP="IDC DSP COR ADM DEVi TAIi PSA PSD IVAi IVDi CONi HIS OUR IND CNT"
status
200
x-op-ca
10.2.80.206
server
cloudflare
expect-ct
max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
x-op-release
1
access-control-allow-methods
GET, POST, OPTIONS
access-control-allow-origin
*
cache-control
public, max-age=14400
access-control-allow-credentials
true
x-op-class
optassets
cf-ray
5328ee893e0e6401-FRA
expires
Fri, 08 Nov 2019 20:30:29 GMT
opt-assets.js?1573152994
optassets.ontraport.com/opt_assets
275 KB
276 KB
Script
General
Full URL
https://optassets.ontraport.com/opt_assets/opt-assets.js?1573152994
Requested by
Host: appraisalreappraisalstaff.qwkcheckout.com
URL: https://appraisalreappraisalstaff.qwkcheckout.com/
Protocol
H2
Security
TLS 1.2, ECDHE_RSA, AES_128_GCM
Server
104.16.20.19 , United States, ASN13335 (CLOUDFLARENET - Cloudflare, Inc., US),
Reverse DNS
Software
cloudflare /
Resource Hash
4730f64b3ae1244aaeb5c89b0f1505d9e2510927ad13adecb094ec5e099066f6

Request headers

Sec-Fetch-Mode
no-cors
Referer
https://appraisalreappraisalstaff.qwkcheckout.com/
User-Agent
Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_5) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.70 Safari/537.36

Response headers

date
Fri, 08 Nov 2019 16:30:29 GMT
vary
Accept-Encoding
cf-cache-status
HIT
age
3924
p3p
CP="IDC DSP COR ADM DEVi TAIi PSA PSD IVAi IVDi CONi HIS OUR IND CNT"
status
200
x-op-ca
10.2.80.206
server
cloudflare
expect-ct
max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
x-op-release
1
access-control-allow-methods
GET, POST, OPTIONS
access-control-allow-origin
*
cache-control
public, max-age=14400
access-control-allow-credentials
true
x-op-class
optassets
cf-ray
5328ee893e0f6401-FRA
expires
Fri, 08 Nov 2019 20:30:29 GMT
custom-elements.min.js
optassets.ontraport.com/opt_assets/templates/custom-elements
18 KB
18 KB
Script
General
Full URL
https://optassets.ontraport.com/opt_assets/templates/custom-elements/custom-elements.min.js
Requested by
Host: appraisalreappraisalstaff.qwkcheckout.com
URL: https://appraisalreappraisalstaff.qwkcheckout.com/
Protocol
H2
Security
TLS 1.2, ECDHE_RSA, AES_128_GCM
Server
104.16.20.19 , United States, ASN13335 (CLOUDFLARENET - Cloudflare, Inc., US),
Reverse DNS
Software
cloudflare /
Resource Hash
73a9c7944ce696c3622189e2f0706ccb9b9033b10f707414fe0ae14be6d68f08

Request headers

Sec-Fetch-Mode
no-cors
Referer
https://appraisalreappraisalstaff.qwkcheckout.com/
User-Agent
Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_5) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.70 Safari/537.36

Response headers

date
Fri, 08 Nov 2019 16:30:29 GMT
vary
Accept-Encoding
cf-cache-status
HIT
age
2174
p3p
CP="IDC DSP COR ADM DEVi TAIi PSA PSD IVAi IVDi CONi HIS OUR IND CNT"
status
200
x-op-ca
10.2.80.206
server
cloudflare
expect-ct
max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
x-op-release
1
access-control-allow-methods
GET, POST, OPTIONS
access-control-allow-origin
*
cache-control
public, max-age=14400
access-control-allow-credentials
true
x-op-class
optassets
cf-ray
5328ee893e106401-FRA
expires
Fri, 08 Nov 2019 20:30:29 GMT
tracking.js
optassets.ontraport.com
10 KB
3 KB
Script
General
Full URL
https://optassets.ontraport.com/tracking.js
Requested by
Host: appraisalreappraisalstaff.qwkcheckout.com
URL: https://appraisalreappraisalstaff.qwkcheckout.com/
Protocol
H2
Security
TLS 1.2, ECDHE_RSA, AES_128_GCM
Server
104.16.20.19 , United States, ASN13335 (CLOUDFLARENET - Cloudflare, Inc., US),
Reverse DNS
Software
cloudflare /
Resource Hash
bd536bda12f3412d79f47f4aab0d693fd32cfa3fcbefbebcecde78c8116274bf

Request headers

Sec-Fetch-Mode
no-cors
Referer
https://appraisalreappraisalstaff.qwkcheckout.com/
User-Agent
Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_5) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.70 Safari/537.36

Response headers

date
Fri, 08 Nov 2019 16:30:29 GMT
content-encoding
br
vary
Accept-Encoding
cf-cache-status
HIT
age
4894
p3p
CP="IDC DSP COR ADM DEVi TAIi PSA PSD IVAi IVDi CONi HIS OUR IND CNT"
status
200
x-op-ca
10.2.80.206
server
cloudflare
expect-ct
max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
x-op-release
1
access-control-allow-methods
GET, POST, OPTIONS
content-type
text/html
access-control-allow-origin
*
cache-control
public, max-age=14400
access-control-allow-credentials
true
x-op-class
optassets
cf-ray
5328ee893e116401-FRA
expires
Fri, 08 Nov 2019 20:30:29 GMT
css?family=Nixie+One%7CDosis:400,200,300,500,600,800,700%7CBubblegum+Sans%7CParisienne%7CLora:400,700i,700,400i%7CFredericka+the+Great%7CNoto+Serif:400,400i,700,700i%7CLa+Belle+Aurore%7CLobster%7CE...
fonts.googleapis.com
276 KB
11 KB
Stylesheet
General
Full URL
https://fonts.googleapis.com/css?family=Nixie+One|Dosis:400,200,300,500,600,800,700|Bubblegum+Sans|Parisienne|Lora:400,700i,700,400i|Fredericka+the+Great|Noto+Serif:400,400i,700,700i|La+Belle+Aurore|Lobster|Engagement|Shadows+Into+Light|Frijole|Alegreya+Sans:400,100,100i,300,300i,400i,500,500i,700,700i,800,900,800i,900i|Monoton|Droid+Serif:400,400i,700,700i|Pacifico|Inconsolata:400,700|Oswald:400,700,300|Special+Elite|Montserrat:400,700|Open+Sans:400,300,300i,400i,600,600i,700,700i,800,800i|Open+Sans+Condensed:300,700,300i|Kranky|Crimson+Text:400,400i,600,700,600i,700i|Indie+Flower|Alegreya:400,400i,700,700i,900i,900|Raleway:100,200,300,500,400,600,700,800,900|Roboto+Condensed:400,300,300i,400i,700,700i|Slabo+27px|Roboto:400,100,100i,300,300i,400i,500,500i,700,700i,900,900i|Lato:400,100,100i,300,300i,400i,700,700i,900,900i|Bentham|Playfair+Display:400,400i,700,700i,900,900i|Paytone+One|Josefin+Slab:400,100,100i,300,300i,400i,600,600i,700,700i|Pinyon+Script|Abril+Fatface|Six+Caps|Londrina+Outline|League+Script|Sacramento|Fjalla+One|Vast+Shadow|Petit+Formal+Script|Libre+Baskerville:400,400i,700|Work+Sans:400,100,200,300,500,600,700,800,900|Economica:400,400i,700,700i|Yellowtail|Niconne|Pompiere|Maiden+Orange|Lateef|Source+Sans+Pro|Anonymous+Pro:400,400i,700,700i|Cormorant:300,300i,400,400i,500,500i,600,600i,700,700i|Karla:400,400i,700,700i|Permanent+Marker|Space+Mono:400,400i,700,700i|Ubuntu:300,300i,400,400i,500,500i,700,700i
Requested by
Host: appraisalreappraisalstaff.qwkcheckout.com
URL: https://appraisalreappraisalstaff.qwkcheckout.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2a00:1450:4001:820::200a Frankfurt am Main, Germany, ASN15169 (GOOGLE - Google LLC, US),
Reverse DNS
Software
ESF /
Resource Hash
73131ea4936a5fb88ce8a345ea86dc1293a23658039eee8bbf1b3e895fb13c4b
Security Headers
Name Value
Strict-Transport-Security max-age=31536000
X-Frame-Options SAMEORIGIN
X-Xss-Protection 0

Request headers

Sec-Fetch-Mode
no-cors
Referer
https://appraisalreappraisalstaff.qwkcheckout.com/
User-Agent
Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_5) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.70 Safari/537.36

Response headers

strict-transport-security
max-age=31536000
content-encoding
br
last-modified
Fri, 08 Nov 2019 16:30:29 GMT
server
ESF
link
<https://fonts.gstatic.com>; rel=preconnect; crossorigin
status
200
date
Fri, 08 Nov 2019 16:30:29 GMT
x-frame-options
SAMEORIGIN
content-type
text/css; charset=utf-8
access-control-allow-origin
*
cache-control
private, max-age=86400, stale-while-revalidate=604800
timing-allow-origin
*
alt-svc
quic=":443"; ma=2592000; v="46,43",h3-Q050=":443"; ma=2592000,h3-Q049=":443"; ma=2592000,h3-Q048=":443"; ma=2592000,h3-Q046=":443"; ma=2592000,h3-Q043=":443"; ma=2592000
x-xss-protection
0
expires
Fri, 08 Nov 2019 16:30:29 GMT
KFOjCnqEu92Fr1Mu51TzBic6CsTYl4BO.woff2
fonts.gstatic.com/s/roboto/v20
12 KB
13 KB
Font
General
Full URL
https://fonts.gstatic.com/s/roboto/v20/KFOjCnqEu92Fr1Mu51TzBic6CsTYl4BO.woff2
Requested by
Host: appraisalreappraisalstaff.qwkcheckout.com
URL: https://appraisalreappraisalstaff.qwkcheckout.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2a00:1450:4001:818::2003 Frankfurt am Main, Germany, ASN15169 (GOOGLE - Google LLC, US),
Reverse DNS
Software
sffe /
Resource Hash
d630df8a89d2ec3c590c3b036b610c60fda3df53b3a4c81f3a9e5c94a0de5929
Security Headers
Name Value
X-Content-Type-Options nosniff
X-Xss-Protection 0

Request headers

Sec-Fetch-Mode
cors
Referer
https://fonts.googleapis.com/css?family=Nixie+One|Dosis:400,200,300,500,600,800,700|Bubblegum+Sans|Parisienne|Lora:400,700i,700,400i|Fredericka+the+Great|Noto+Serif:400,400i,700,700i|La+Belle+Aurore|Lobster|Engagement|Shadows+Into+Light|Frijole|Alegreya+Sans:400,100,100i,300,300i,400i,500,500i,700,700i,800,900,800i,900i|Monoton|Droid+Serif:400,400i,700,700i|Pacifico|Inconsolata:400,700|Oswald:400,700,300|Special+Elite|Montserrat:400,700|Open+Sans:400,300,300i,400i,600,600i,700,700i,800,800i|Open+Sans+Condensed:300,700,300i|Kranky|Crimson+Text:400,400i,600,700,600i,700i|Indie+Flower|Alegreya:400,400i,700,700i,900i,900|Raleway:100,200,300,500,400,600,700,800,900|Roboto+Condensed:400,300,300i,400i,700,700i|Slabo+27px|Roboto:400,100,100i,300,300i,400i,500,500i,700,700i,900,900i|Lato:400,100,100i,300,300i,400i,700,700i,900,900i|Bentham|Playfair+Display:400,400i,700,700i,900,900i|Paytone+One|Josefin+Slab:400,100,100i,300,300i,400i,600,600i,700,700i|Pinyon+Script|Abril+Fatface|Six+Caps|Londrina+Outline|League+Script|Sacramento|Fjalla+One|Vast+Shadow|Petit+Formal+Script|Libre+Baskerville:400,400i,700|Work+Sans:400,100,200,300,500,600,700,800,900|Economica:400,400i,700,700i|Yellowtail|Niconne|Pompiere|Maiden+Orange|Lateef|Source+Sans+Pro|Anonymous+Pro:400,400i,700,700i|Cormorant:300,300i,400,400i,500,500i,600,600i,700,700i|Karla:400,400i,700,700i|Permanent+Marker|Space+Mono:400,400i,700,700i|Ubuntu:300,300i,400,400i,500,500i,700,700i
Origin
https://appraisalreappraisalstaff.qwkcheckout.com
User-Agent
Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_5) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.70 Safari/537.36

Response headers

date
Wed, 30 Oct 2019 07:36:05 GMT
x-content-type-options
nosniff
last-modified
Wed, 24 Jul 2019 01:19:03 GMT
server
sffe
age
809664
status
200
content-type
font/woff2
access-control-allow-origin
*
cache-control
public, max-age=31536000
accept-ranges
bytes
timing-allow-origin
*
alt-svc
quic=":443"; ma=2592000; v="46,43",h3-Q050=":443"; ma=2592000,h3-Q049=":443"; ma=2592000,h3-Q048=":443"; ma=2592000,h3-Q046=":443"; ma=2592000,h3-Q043=":443"; ma=2592000
content-length
12688
x-xss-protection
0
expires
Thu, 29 Oct 2020 07:36:05 GMT
KFOlCnqEu92Fr1MmEU9fBBc4AMP6lQ.woff2
fonts.gstatic.com/s/roboto/v20
11 KB
11 KB
Font
General
Full URL
https://fonts.gstatic.com/s/roboto/v20/KFOlCnqEu92Fr1MmEU9fBBc4AMP6lQ.woff2
Requested by
Host: appraisalreappraisalstaff.qwkcheckout.com
URL: https://appraisalreappraisalstaff.qwkcheckout.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2a00:1450:4001:818::2003 Frankfurt am Main, Germany, ASN15169 (GOOGLE - Google LLC, US),
Reverse DNS
Software
sffe /
Resource Hash
ce897833ac6e362df7c91ac8223fe511c6defcf33964928a81004600a2dd4c2e
Security Headers
Name Value
X-Content-Type-Options nosniff
X-Xss-Protection 0

Request headers

Sec-Fetch-Mode
cors
Referer
https://fonts.googleapis.com/css?family=Nixie+One|Dosis:400,200,300,500,600,800,700|Bubblegum+Sans|Parisienne|Lora:400,700i,700,400i|Fredericka+the+Great|Noto+Serif:400,400i,700,700i|La+Belle+Aurore|Lobster|Engagement|Shadows+Into+Light|Frijole|Alegreya+Sans:400,100,100i,300,300i,400i,500,500i,700,700i,800,900,800i,900i|Monoton|Droid+Serif:400,400i,700,700i|Pacifico|Inconsolata:400,700|Oswald:400,700,300|Special+Elite|Montserrat:400,700|Open+Sans:400,300,300i,400i,600,600i,700,700i,800,800i|Open+Sans+Condensed:300,700,300i|Kranky|Crimson+Text:400,400i,600,700,600i,700i|Indie+Flower|Alegreya:400,400i,700,700i,900i,900|Raleway:100,200,300,500,400,600,700,800,900|Roboto+Condensed:400,300,300i,400i,700,700i|Slabo+27px|Roboto:400,100,100i,300,300i,400i,500,500i,700,700i,900,900i|Lato:400,100,100i,300,300i,400i,700,700i,900,900i|Bentham|Playfair+Display:400,400i,700,700i,900,900i|Paytone+One|Josefin+Slab:400,100,100i,300,300i,400i,600,600i,700,700i|Pinyon+Script|Abril+Fatface|Six+Caps|Londrina+Outline|League+Script|Sacramento|Fjalla+One|Vast+Shadow|Petit+Formal+Script|Libre+Baskerville:400,400i,700|Work+Sans:400,100,200,300,500,600,700,800,900|Economica:400,400i,700,700i|Yellowtail|Niconne|Pompiere|Maiden+Orange|Lateef|Source+Sans+Pro|Anonymous+Pro:400,400i,700,700i|Cormorant:300,300i,400,400i,500,500i,600,600i,700,700i|Karla:400,400i,700,700i|Permanent+Marker|Space+Mono:400,400i,700,700i|Ubuntu:300,300i,400,400i,500,500i,700,700i
Origin
https://appraisalreappraisalstaff.qwkcheckout.com
User-Agent
Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_5) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.70 Safari/537.36

Response headers

date
Wed, 30 Oct 2019 14:33:54 GMT
x-content-type-options
nosniff
last-modified
Wed, 24 Jul 2019 01:18:48 GMT
server
sffe
age
784595
status
200
content-type
font/woff2
access-control-allow-origin
*
cache-control
public, max-age=31536000
accept-ranges
bytes
timing-allow-origin
*
alt-svc
quic=":443"; ma=2592000; v="46,43",h3-Q050=":443"; ma=2592000,h3-Q049=":443"; ma=2592000,h3-Q048=":443"; ma=2592000,h3-Q046=":443"; ma=2592000,h3-Q043=":443"; ma=2592000
content-length
11056
x-xss-protection
0
expires
Thu, 29 Oct 2020 14:33:54 GMT
KFOlCnqEu92Fr1MmWUlfBBc4AMP6lQ.woff2
fonts.gstatic.com/s/roboto/v20
11 KB
11 KB
Font
General
Full URL
https://fonts.gstatic.com/s/roboto/v20/KFOlCnqEu92Fr1MmWUlfBBc4AMP6lQ.woff2
Requested by
Host: appraisalreappraisalstaff.qwkcheckout.com
URL: https://appraisalreappraisalstaff.qwkcheckout.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2a00:1450:4001:818::2003 Frankfurt am Main, Germany, ASN15169 (GOOGLE - Google LLC, US),
Reverse DNS
Software
sffe /
Resource Hash
0d9fd7ccabde9b202de45ee6b65878ce9594975d8e8810b0878d3f3fa3637d0e
Security Headers
Name Value
X-Content-Type-Options nosniff
X-Xss-Protection 0

Request headers

Sec-Fetch-Mode
cors
Referer
https://fonts.googleapis.com/css?family=Nixie+One|Dosis:400,200,300,500,600,800,700|Bubblegum+Sans|Parisienne|Lora:400,700i,700,400i|Fredericka+the+Great|Noto+Serif:400,400i,700,700i|La+Belle+Aurore|Lobster|Engagement|Shadows+Into+Light|Frijole|Alegreya+Sans:400,100,100i,300,300i,400i,500,500i,700,700i,800,900,800i,900i|Monoton|Droid+Serif:400,400i,700,700i|Pacifico|Inconsolata:400,700|Oswald:400,700,300|Special+Elite|Montserrat:400,700|Open+Sans:400,300,300i,400i,600,600i,700,700i,800,800i|Open+Sans+Condensed:300,700,300i|Kranky|Crimson+Text:400,400i,600,700,600i,700i|Indie+Flower|Alegreya:400,400i,700,700i,900i,900|Raleway:100,200,300,500,400,600,700,800,900|Roboto+Condensed:400,300,300i,400i,700,700i|Slabo+27px|Roboto:400,100,100i,300,300i,400i,500,500i,700,700i,900,900i|Lato:400,100,100i,300,300i,400i,700,700i,900,900i|Bentham|Playfair+Display:400,400i,700,700i,900,900i|Paytone+One|Josefin+Slab:400,100,100i,300,300i,400i,600,600i,700,700i|Pinyon+Script|Abril+Fatface|Six+Caps|Londrina+Outline|League+Script|Sacramento|Fjalla+One|Vast+Shadow|Petit+Formal+Script|Libre+Baskerville:400,400i,700|Work+Sans:400,100,200,300,500,600,700,800,900|Economica:400,400i,700,700i|Yellowtail|Niconne|Pompiere|Maiden+Orange|Lateef|Source+Sans+Pro|Anonymous+Pro:400,400i,700,700i|Cormorant:300,300i,400,400i,500,500i,600,600i,700,700i|Karla:400,400i,700,700i|Permanent+Marker|Space+Mono:400,400i,700,700i|Ubuntu:300,300i,400,400i,500,500i,700,700i
Origin
https://appraisalreappraisalstaff.qwkcheckout.com
User-Agent
Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_5) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.70 Safari/537.36

Response headers

date
Mon, 28 Oct 2019 17:54:33 GMT
x-content-type-options
nosniff
last-modified
Wed, 24 Jul 2019 01:18:58 GMT
server
sffe
age
945356
status
200
content-type
font/woff2
access-control-allow-origin
*
cache-control
public, max-age=31536000
accept-ranges
bytes
timing-allow-origin
*
alt-svc
quic=":443"; ma=2592000; v="46,43",h3-Q050=":443"; ma=2592000,h3-Q049=":443"; ma=2592000,h3-Q048=":443"; ma=2592000,h3-Q046=":443"; ma=2592000,h3-Q043=":443"; ma=2592000
content-length
11020
x-xss-protection
0
expires
Tue, 27 Oct 2020 17:54:33 GMT
KFOlCnqEu92Fr1MmSU5fBBc4AMP6lQ.woff2
fonts.gstatic.com/s/roboto/v20
11 KB
11 KB
Font
General
Full URL
https://fonts.gstatic.com/s/roboto/v20/KFOlCnqEu92Fr1MmSU5fBBc4AMP6lQ.woff2
Requested by
Host: appraisalreappraisalstaff.qwkcheckout.com
URL: https://appraisalreappraisalstaff.qwkcheckout.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2a00:1450:4001:818::2003 Frankfurt am Main, Germany, ASN15169 (GOOGLE - Google LLC, US),
Reverse DNS
Software
sffe /
Resource Hash
92606bd38901e67d069f2ef883715b6e5ae07d72ae3bead3ad92346528374afc
Security Headers
Name Value
X-Content-Type-Options nosniff
X-Xss-Protection 0

Request headers

Sec-Fetch-Mode
cors
Referer
https://fonts.googleapis.com/css?family=Nixie+One|Dosis:400,200,300,500,600,800,700|Bubblegum+Sans|Parisienne|Lora:400,700i,700,400i|Fredericka+the+Great|Noto+Serif:400,400i,700,700i|La+Belle+Aurore|Lobster|Engagement|Shadows+Into+Light|Frijole|Alegreya+Sans:400,100,100i,300,300i,400i,500,500i,700,700i,800,900,800i,900i|Monoton|Droid+Serif:400,400i,700,700i|Pacifico|Inconsolata:400,700|Oswald:400,700,300|Special+Elite|Montserrat:400,700|Open+Sans:400,300,300i,400i,600,600i,700,700i,800,800i|Open+Sans+Condensed:300,700,300i|Kranky|Crimson+Text:400,400i,600,700,600i,700i|Indie+Flower|Alegreya:400,400i,700,700i,900i,900|Raleway:100,200,300,500,400,600,700,800,900|Roboto+Condensed:400,300,300i,400i,700,700i|Slabo+27px|Roboto:400,100,100i,300,300i,400i,500,500i,700,700i,900,900i|Lato:400,100,100i,300,300i,400i,700,700i,900,900i|Bentham|Playfair+Display:400,400i,700,700i,900,900i|Paytone+One|Josefin+Slab:400,100,100i,300,300i,400i,600,600i,700,700i|Pinyon+Script|Abril+Fatface|Six+Caps|Londrina+Outline|League+Script|Sacramento|Fjalla+One|Vast+Shadow|Petit+Formal+Script|Libre+Baskerville:400,400i,700|Work+Sans:400,100,200,300,500,600,700,800,900|Economica:400,400i,700,700i|Yellowtail|Niconne|Pompiere|Maiden+Orange|Lateef|Source+Sans+Pro|Anonymous+Pro:400,400i,700,700i|Cormorant:300,300i,400,400i,500,500i,600,600i,700,700i|Karla:400,400i,700,700i|Permanent+Marker|Space+Mono:400,400i,700,700i|Ubuntu:300,300i,400,400i,500,500i,700,700i
Origin
https://appraisalreappraisalstaff.qwkcheckout.com
User-Agent
Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_5) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.70 Safari/537.36

Response headers

date
Fri, 01 Nov 2019 16:11:16 GMT
x-content-type-options
nosniff
last-modified
Wed, 24 Jul 2019 01:18:52 GMT
server
sffe
age
605953
status
200
content-type
font/woff2
access-control-allow-origin
*
cache-control
public, max-age=31536000
accept-ranges
bytes
timing-allow-origin
*
alt-svc
quic=":443"; ma=2592000; v="46,43",h3-Q050=":443"; ma=2592000,h3-Q049=":443"; ma=2592000,h3-Q048=":443"; ma=2592000,h3-Q046=":443"; ma=2592000,h3-Q043=":443"; ma=2592000
content-length
11180
x-xss-protection
0
expires
Sat, 31 Oct 2020 16:11:16 GMT
KFOjCnqEu92Fr1Mu51TjASc6CsTYl4BO.woff2
fonts.gstatic.com/s/roboto/v20
13 KB
13 KB
Font
General
Full URL
https://fonts.gstatic.com/s/roboto/v20/KFOjCnqEu92Fr1Mu51TjASc6CsTYl4BO.woff2
Requested by
Host: appraisalreappraisalstaff.qwkcheckout.com
URL: https://appraisalreappraisalstaff.qwkcheckout.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2a00:1450:4001:818::2003 Frankfurt am Main, Germany, ASN15169 (GOOGLE - Google LLC, US),
Reverse DNS
Software
sffe /
Resource Hash
4c575d67f22342308c6bdc002dce3d2bf2eb03c3434846dd8aeb4b2b74b43d43
Security Headers
Name Value
X-Content-Type-Options nosniff
X-Xss-Protection 0

Request headers

Sec-Fetch-Mode
cors
Referer
https://fonts.googleapis.com/css?family=Nixie+One|Dosis:400,200,300,500,600,800,700|Bubblegum+Sans|Parisienne|Lora:400,700i,700,400i|Fredericka+the+Great|Noto+Serif:400,400i,700,700i|La+Belle+Aurore|Lobster|Engagement|Shadows+Into+Light|Frijole|Alegreya+Sans:400,100,100i,300,300i,400i,500,500i,700,700i,800,900,800i,900i|Monoton|Droid+Serif:400,400i,700,700i|Pacifico|Inconsolata:400,700|Oswald:400,700,300|Special+Elite|Montserrat:400,700|Open+Sans:400,300,300i,400i,600,600i,700,700i,800,800i|Open+Sans+Condensed:300,700,300i|Kranky|Crimson+Text:400,400i,600,700,600i,700i|Indie+Flower|Alegreya:400,400i,700,700i,900i,900|Raleway:100,200,300,500,400,600,700,800,900|Roboto+Condensed:400,300,300i,400i,700,700i|Slabo+27px|Roboto:400,100,100i,300,300i,400i,500,500i,700,700i,900,900i|Lato:400,100,100i,300,300i,400i,700,700i,900,900i|Bentham|Playfair+Display:400,400i,700,700i,900,900i|Paytone+One|Josefin+Slab:400,100,100i,300,300i,400i,600,600i,700,700i|Pinyon+Script|Abril+Fatface|Six+Caps|Londrina+Outline|League+Script|Sacramento|Fjalla+One|Vast+Shadow|Petit+Formal+Script|Libre+Baskerville:400,400i,700|Work+Sans:400,100,200,300,500,600,700,800,900|Economica:400,400i,700,700i|Yellowtail|Niconne|Pompiere|Maiden+Orange|Lateef|Source+Sans+Pro|Anonymous+Pro:400,400i,700,700i|Cormorant:300,300i,400,400i,500,500i,600,600i,700,700i|Karla:400,400i,700,700i|Permanent+Marker|Space+Mono:400,400i,700,700i|Ubuntu:300,300i,400,400i,500,500i,700,700i
Origin
https://appraisalreappraisalstaff.qwkcheckout.com
User-Agent
Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_5) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.70 Safari/537.36

Response headers

date
Thu, 31 Oct 2019 10:38:08 GMT
x-content-type-options
nosniff
last-modified
Wed, 24 Jul 2019 01:18:39 GMT
server
sffe
age
712341
status
200
content-type
font/woff2
access-control-allow-origin
*
cache-control
public, max-age=31536000
accept-ranges
bytes
timing-allow-origin
*
alt-svc
quic=":443"; ma=2592000; v="46,43",h3-Q050=":443"; ma=2592000,h3-Q049=":443"; ma=2592000,h3-Q048=":443"; ma=2592000,h3-Q046=":443"; ma=2592000,h3-Q043=":443"; ma=2592000
content-length
12824
x-xss-protection
0
expires
Fri, 30 Oct 2020 10:38:08 GMT
KFOmCnqEu92Fr1Mu4mxKKTU1Kg.woff2
fonts.gstatic.com/s/roboto/v20
11 KB
11 KB
Font
General
Full URL
https://fonts.gstatic.com/s/roboto/v20/KFOmCnqEu92Fr1Mu4mxKKTU1Kg.woff2
Requested by
Host: appraisalreappraisalstaff.qwkcheckout.com
URL: https://appraisalreappraisalstaff.qwkcheckout.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2a00:1450:4001:818::2003 Frankfurt am Main, Germany, ASN15169 (GOOGLE - Google LLC, US),
Reverse DNS
Software
sffe /
Resource Hash
5d1bc9b443f3f81fa4b4ad4634c1bb9702194c1898e3a9de0ab5e2cdc0e9f479
Security Headers
Name Value
X-Content-Type-Options nosniff
X-Xss-Protection 0

Request headers

Sec-Fetch-Mode
cors
Referer
https://fonts.googleapis.com/css?family=Nixie+One|Dosis:400,200,300,500,600,800,700|Bubblegum+Sans|Parisienne|Lora:400,700i,700,400i|Fredericka+the+Great|Noto+Serif:400,400i,700,700i|La+Belle+Aurore|Lobster|Engagement|Shadows+Into+Light|Frijole|Alegreya+Sans:400,100,100i,300,300i,400i,500,500i,700,700i,800,900,800i,900i|Monoton|Droid+Serif:400,400i,700,700i|Pacifico|Inconsolata:400,700|Oswald:400,700,300|Special+Elite|Montserrat:400,700|Open+Sans:400,300,300i,400i,600,600i,700,700i,800,800i|Open+Sans+Condensed:300,700,300i|Kranky|Crimson+Text:400,400i,600,700,600i,700i|Indie+Flower|Alegreya:400,400i,700,700i,900i,900|Raleway:100,200,300,500,400,600,700,800,900|Roboto+Condensed:400,300,300i,400i,700,700i|Slabo+27px|Roboto:400,100,100i,300,300i,400i,500,500i,700,700i,900,900i|Lato:400,100,100i,300,300i,400i,700,700i,900,900i|Bentham|Playfair+Display:400,400i,700,700i,900,900i|Paytone+One|Josefin+Slab:400,100,100i,300,300i,400i,600,600i,700,700i|Pinyon+Script|Abril+Fatface|Six+Caps|Londrina+Outline|League+Script|Sacramento|Fjalla+One|Vast+Shadow|Petit+Formal+Script|Libre+Baskerville:400,400i,700|Work+Sans:400,100,200,300,500,600,700,800,900|Economica:400,400i,700,700i|Yellowtail|Niconne|Pompiere|Maiden+Orange|Lateef|Source+Sans+Pro|Anonymous+Pro:400,400i,700,700i|Cormorant:300,300i,400,400i,500,500i,600,600i,700,700i|Karla:400,400i,700,700i|Permanent+Marker|Space+Mono:400,400i,700,700i|Ubuntu:300,300i,400,400i,500,500i,700,700i
Origin
https://appraisalreappraisalstaff.qwkcheckout.com
User-Agent
Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_5) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.70 Safari/537.36

Response headers

date
Thu, 31 Oct 2019 18:43:13 GMT
x-content-type-options
nosniff
last-modified
Wed, 24 Jul 2019 01:18:50 GMT
server
sffe
age
683236
status
200
content-type
font/woff2
access-control-allow-origin
*
cache-control
public, max-age=31536000
accept-ranges
bytes
timing-allow-origin
*
alt-svc
quic=":443"; ma=2592000; v="46,43",h3-Q050=":443"; ma=2592000,h3-Q049=":443"; ma=2592000,h3-Q048=":443"; ma=2592000,h3-Q046=":443"; ma=2592000,h3-Q043=":443"; ma=2592000
content-length
11016
x-xss-protection
0
expires
Fri, 30 Oct 2020 18:43:13 GMT
opf.js
app.ontraport.com/js/ontraport/opt_assets/drivers
63 KB
21 KB
Script
General
Full URL
https://app.ontraport.com/js/ontraport/opt_assets/drivers/opf.js
Requested by
Host: optassets.ontraport.com
URL: https://optassets.ontraport.com/opt_assets/opt-assets.js?1573152994
Protocol
H2
Security
TLS 1.2, ECDHE_RSA, AES_128_GCM
Server
104.16.20.19 , United States, ASN13335 (CLOUDFLARENET - Cloudflare, Inc., US),
Reverse DNS
Software
cloudflare /
Resource Hash
2b92dc5f20701766be73332675a1fc53c0b5d95d98fb5c5e3c56681fbd86c383

Request headers

Sec-Fetch-Mode
no-cors
Referer
https://appraisalreappraisalstaff.qwkcheckout.com/
User-Agent
Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_5) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.70 Safari/537.36

Response headers

date
Fri, 08 Nov 2019 16:30:29 GMT
x-op-benvironment
production
vary
Accept-Encoding
cf-cache-status
HIT
age
298
p3p
CP="IDC DSP COR ADM DEVi TAIi PSA PSD IVAi IVDi CONi HIS OUR IND CNT"
status
200
content-encoding
br
x-op-ca
10.2.80.206
last-modified
Thu, 07 Nov 2019 19:04:48 GMT
server
cloudflare
etag
W/"5dc46ad0-fbe9"
expect-ct
max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
x-op-release
1
content-type
application/javascript
cache-control
public, max-age=300
x-op-class
app
cf-ray
5328ee8a3f4c6401-FRA
expires
Fri, 08 Nov 2019 16:35:29 GMT
&ti=&forms%5Bp2c210891lp1.0.bid2bb6d24c-b363-0eba-ee02-50254af66ab8%5D=0&is_unique=1
vcd.ontraport.com/track.php?mid=210891_lp1.0_2&llc=https://appraisalreappraisalstaff.qwkcheckout.com/&first_visit=1&referral_page=&s=fnqy48cfg193cfg3fk20&l=appraisalreappraisalstaff.qwkcheckout.com
796 B
1008 B
Script
General
Full URL
https://vcd.ontraport.com/track.php?mid=210891_lp1.0_2&llc=https://appraisalreappraisalstaff.qwkcheckout.com/&first_visit=1&referral_page=&s=fnqy48cfg193cfg3fk20&l=appraisalreappraisalstaff.qwkcheckout.com/&ti=&forms%5Bp2c210891lp1.0.bid2bb6d24c-b363-0eba-ee02-50254af66ab8%5D=0&is_unique=1
Requested by
Host: optassets.ontraport.com
URL: https://optassets.ontraport.com/tracking.js
Protocol
HTTP/1.1
Security
TLS 1.2, ECDHE_RSA, AES_128_GCM
Server
209.170.211.179 Venice, United States, ASN13649 (ASN-VINS - ViaWest, US),
Reverse DNS
mail9.ontramail.com
Software
ONTRAport /
Resource Hash
ee597374a2bafdf58b5c3bfdb7e7a695477af120c0a111936219e61f5915eba0

Request headers

Sec-Fetch-Mode
no-cors
Referer
https://appraisalreappraisalstaff.qwkcheckout.com/
User-Agent
Mozilla/5.0 (Macintosh; Intel Mac OS X 10_14_5) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/78.0.3904.70 Safari/537.36

Response headers

Date
Fri, 08 Nov 2019 16:30:30 GMT
Content-Encoding
gzip
X-op-class
hosted
Server
ONTRAport
X-op-release
1
Vary
Accept-Encoding
Access-Control-Allow-Methods
GET, POST, OPTIONS
P3P
CP="IDC DSP COR ADM DEVi TAIi PSA PSD IVAi IVDi CONi HIS OUR IND CNT"
Access-Control-Allow-Origin
*
Transfer-Encoding
chunked
Connection
keep-alive
Access-Control-Allow-Credentials
true
Content-Type
text/html
X-op-ca
144.76.109.30

Redirect requests

There were HTTP redirects (301, 302) for the following requests:

Request 0
  • http://appraisalreappraisalstaff.qwkcheckout.com/
  • https://appraisalreappraisalstaff.qwkcheckout.com/

62 JavaScript Global Variables

These are the non-standard "global" variables defined on the window object. These can be helpful in identifying possible client-side frameworks and code.

object| onformdata object| onpointerrawupdate object| op string| _opt_lpid boolean| isONTRApage object| $jscomp object| $jscomp$this function| anime function| $ function| jQuery function| cash object| M object| Materialize function| Hammer object| desExport function| des function| des_createKeys function| stringToHex function| hexToString object| XD number| ACCOUNT_SIGNUP_ERROR number| CC_VERIFY_POST number| CC_VERIFY_SHOW_IFRAME number| CC_VERIFY_HIDE_IFRAME number| CC_VERIFY_GET_CC_DATA string| PROTOCOL string| COUPON_PROCESS_DOMAIN boolean| IN_DEBUG_MODE string| FORM_PROCESS_DOMAIN string| CC_VERIFY_DOMAIN function| _debugLog function| OPCapcha_filled function| OPCapcha_expired function| Globalize function| OptDateTimePicker string| _mri string| _mrq string| _mrsess_ undefined| _mr_cid object| _mrd string| _mrl object| _mrct string| _mr_ex string| _linktrack string| _mr_title string| _mrl_internal_url string| _mrl_internal_domain function| mrSetupActual function| mrtracking function| gC function| parseGetVars function| genmrSess function| _escapeT function| _mrGetLinkTo function| _sanitizeMrLink function| _mrScanLinks function| _mrTrackLink function| _mrReturnXmlHttpObject string| _mr_domain string| session string| possible object| _mrTrackLinks

5 Cookies

Domain/Path Name / Value
appraisalreappraisalstaff.qwkcheckout.com/ Name: lastvisit
Value: 1573230629
appraisalreappraisalstaff.qwkcheckout.com/ Name: vid
Value:
appraisalreappraisalstaff.qwkcheckout.com/ Name: referral_page
Value:
appraisalreappraisalstaff.qwkcheckout.com/ Name: sess_
Value: fnqy48cfg193cfg3fk20
appraisalreappraisalstaff.qwkcheckout.com/ Name: lpsplt_1
Value: 0

Indicators

This is a term in the security industry to describe indicators such as IPs, Domains, Hashes, etc. This does not imply that any of these indicate malicious activity.

app.ontraport.com
appraisalreappraisalstaff.qwkcheckout.com
fonts.googleapis.com
fonts.gstatic.com
optassets.ontraport.com
vcd.ontraport.com
104.16.20.19
209.170.211.179
2a00:1450:4001:818::2003
2a00:1450:4001:820::200a
09e13bc501877a8383c2661e6fc80187efadbd82ac4d3b0d1ec8a41d8630756c
0d9fd7ccabde9b202de45ee6b65878ce9594975d8e8810b0878d3f3fa3637d0e
2b92dc5f20701766be73332675a1fc53c0b5d95d98fb5c5e3c56681fbd86c383
2c2348bbc056a14a9cd62dadb8d461800a192e8ba636f803d0ffddd753977976
36181ad51326af0782a96f7f9dc1014707b787c5ae5dc023a9de8f16308043b0
4730f64b3ae1244aaeb5c89b0f1505d9e2510927ad13adecb094ec5e099066f6
4c575d67f22342308c6bdc002dce3d2bf2eb03c3434846dd8aeb4b2b74b43d43
5d1bc9b443f3f81fa4b4ad4634c1bb9702194c1898e3a9de0ab5e2cdc0e9f479
73131ea4936a5fb88ce8a345ea86dc1293a23658039eee8bbf1b3e895fb13c4b
73a9c7944ce696c3622189e2f0706ccb9b9033b10f707414fe0ae14be6d68f08
92606bd38901e67d069f2ef883715b6e5ae07d72ae3bead3ad92346528374afc
bd536bda12f3412d79f47f4aab0d693fd32cfa3fcbefbebcecde78c8116274bf
bf2fc030b35e1304c3a4e415eb9487ec464a2c2017ab9a3df02d35a5f2d290b3
ce897833ac6e362df7c91ac8223fe511c6defcf33964928a81004600a2dd4c2e
d3a518dea876de39f9e5dc1ffcdeb6c661aee25d8a62474386b664ef3bf1b40f
d630df8a89d2ec3c590c3b036b610c60fda3df53b3a4c81f3a9e5c94a0de5929
ee597374a2bafdf58b5c3bfdb7e7a695477af120c0a111936219e61f5915eba0