www.workplaceoptions.com
Open in
urlscan Pro
103.72.76.87
Public Scan
URL:
https://www.workplaceoptions.com/ie/payment-center/
Submission: On June 08 via manual from SG — Scanned from SG
Submission: On June 08 via manual from SG — Scanned from SG
Form analysis 9 forms found in the DOM
<form>
<fieldset>
<legend class="visuallyhidden">Consent Selection</legend>
<div id="CybotCookiebotDialogBodyFieldsetInnerContainer">
<div class="CybotCookiebotDialogBodyLevelButtonWrapper"><label class="CybotCookiebotDialogBodyLevelButtonLabel" for="CybotCookiebotDialogBodyLevelButtonNecessary"><strong
class="CybotCookiebotDialogBodyLevelButtonDescription">Necessary</strong></label>
<div class="CybotCookiebotDialogBodyLevelButtonSliderWrapper CybotCookiebotDialogBodyLevelButtonSliderWrapperDisabled"><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonNecessary"
class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelButtonDisabled" disabled="disabled" checked="checked"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></div>
</div>
<div class="CybotCookiebotDialogBodyLevelButtonWrapper"><label class="CybotCookiebotDialogBodyLevelButtonLabel" for="CybotCookiebotDialogBodyLevelButtonPreferences"><strong
class="CybotCookiebotDialogBodyLevelButtonDescription">Preferences</strong></label>
<div class="CybotCookiebotDialogBodyLevelButtonSliderWrapper"><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonPreferences" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox"
data-target="CybotCookiebotDialogBodyLevelButtonPreferencesInline" checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></div>
</div>
<div class="CybotCookiebotDialogBodyLevelButtonWrapper"><label class="CybotCookiebotDialogBodyLevelButtonLabel" for="CybotCookiebotDialogBodyLevelButtonStatistics"><strong
class="CybotCookiebotDialogBodyLevelButtonDescription">Statistics</strong></label>
<div class="CybotCookiebotDialogBodyLevelButtonSliderWrapper"><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonStatistics" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox"
data-target="CybotCookiebotDialogBodyLevelButtonStatisticsInline" checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></div>
</div>
<div class="CybotCookiebotDialogBodyLevelButtonWrapper"><label class="CybotCookiebotDialogBodyLevelButtonLabel" for="CybotCookiebotDialogBodyLevelButtonMarketing"><strong
class="CybotCookiebotDialogBodyLevelButtonDescription">Marketing</strong></label>
<div class="CybotCookiebotDialogBodyLevelButtonSliderWrapper"><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonMarketing" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox"
data-target="CybotCookiebotDialogBodyLevelButtonMarketingInline" checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></div>
</div>
</div>
</fieldset>
</form><form><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonNecessaryInline" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelButtonDisabled" disabled="disabled" checked="checked"> <span
class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form><form><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonPreferencesInline" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox" data-target="CybotCookiebotDialogBodyLevelButtonPreferences"
checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form><form><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonStatisticsInline" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox" data-target="CybotCookiebotDialogBodyLevelButtonStatistics"
checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form><form><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonMarketingInline" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox" data-target="CybotCookiebotDialogBodyLevelButtonMarketing" checked="checked"
tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form><form class="CybotCookiebotDialogBodyLevelButtonSliderWrapper"><input type="checkbox" id="CybotCookiebotDialogBodyContentCheckboxPersonalInformation" class="CybotCookiebotDialogBodyLevelButton"> <span
class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form>GET https://www.workplaceoptions.com/ie/
<form class="glbl_form" id="hdr_srch" role="search" method="get" action="https://www.workplaceoptions.com/ie/">
<div class="srch_box_mob">
<input type="text" placeholder="Search..." value="" name="s" required="">
<button class="serch_btn" type="submit"> <img src="https://www.workplaceoptions.com/ie/wp-content/themes/wpo/images/Icon-map-search.png" alt=""></button><button>
</button>
</div>
</form>GET https://www.workplaceoptions.com/ie/
<form class="glbl_form" id="hdr_srch_mob" role="search" method="get" action="https://www.workplaceoptions.com/ie/">
<div class="srch_box_mob">
<input type="text" placeholder="Search...." value="" name="s" required="">
<button class="serch_btn" type="submit"> <img src="https://www.workplaceoptions.com/ie/wp-content/themes/wpo/images/Icon-map-search.png" alt=""></button><button>
</button>
</div>
</form>POST
<form action="" method="post" class="simpay-checkout-form simpay-form-12110 simpay-checkout-form--stripe_checkout" id="simpay-form-12110" data-simpay-form-id="12110" data-simpay-form-instance="0">
<div class="simpay-form-control simpay-text-container">
<div class="simpay-text-label simpay-label-wrap"><label for="simpay-12110-text-2">Invoice#</label></div>
<div class="simpay-text-wrap simpay-field-wrap"><input type="text" name="simpay_field[Invoice#]" id="simpay-12110-text-2" placeholder="" value="" required="" maxlength="500"> </div>
</div>
<div class="simpay-form-control simpay-text-container">
<div class="simpay-text-label simpay-label-wrap"><label for="simpay-12110-text-3">Company Name</label></div>
<div class="simpay-text-wrap simpay-field-wrap"><input type="text" name="simpay_field[Company Name]" id="simpay-12110-text-3" placeholder="" value="" required="" maxlength="500"> </div>
</div>
<div class="simpay-form-control simpay-dropdown-container">
<div class="simpay-dropdown-label simpay-label-wrap"><label for="simpay-12110-dropdown-4">Choose Currency</label></div>
<div class="simpay-dropdown-wrap simpay-field-wrap"><select name="simpay_field[cur]" id="simpay-12110-dropdown-4" required=""""">
<option>USD</option>
<option>AED</option>
<option>AFN</option>
<option>ALL</option>
<option>AMD</option>
<option>ANG</option>
<option>AOA</option>
<option>ARS</option>
<option>AUD</option>
<option>AWG</option>
<option>AZN</option>
<option>BAM</option>
<option>BBD</option>
<option>BDT</option>
<option>BGN</option>
<option>BIF</option>
<option>BMD</option>
<option>BND</option>
<option>BOB</option>
<option>BRL</option>
<option>BSD</option>
<option>BWP</option>
<option>BZD</option>
<option>CAD</option>
<option>CDF</option>
<option>CHF</option>
<option>CLP</option>
<option>CNY</option>
<option>COP</option>
<option>CRC</option>
<option>CVE</option>
<option>CZK</option>
<option>DJF</option>
<option>DKK</option>
<option>DOP</option>
<option>DZD</option>
<option>EGP</option>
<option>ETB</option>
<option selected="selected">EUR</option>
<option>FJD</option>
<option>FKP</option>
<option>GBP</option>
<option>GEL</option>
<option>GIP</option>
<option>GMD</option>
<option>GNF</option>
<option>GTQ</option>
<option>GYD</option>
<option>HKD</option>
<option>HNL</option>
<option>HRK</option>
<option>HTG</option>
<option>HUF</option>
<option>IDR</option>
<option>ILS</option>
<option>INR</option>
<option>ISK</option>
<option>JMD</option>
<option>JPY</option>
<option>KES</option>
<option>KGS</option>
<option>KHR</option>
<option>KMF</option>
<option>KRW</option>
<option>KYD</option>
<option>KZT</option>
<option>LAK</option>
<option>LBP</option>
<option>LKR</option>
<option>LRD</option>
<option>LSL</option>
<option>MAD</option>
<option>MDL</option>
<option>MGA</option>
<option>MKD</option>
<option>MMK</option>
<option>MNT</option>
<option>MOP</option>
<option>MRO</option>
<option>MUR</option>
<option>MVR</option>
<option>MWK</option>
<option>MXN</option>
<option>MYR</option>
<option>MZN</option>
<option>NAD</option>
<option>NGN</option>
<option>NIO</option>
<option>NOK</option>
<option>NPR</option>
<option>NZD</option>
<option>PAB</option>
<option>PEN</option>
<option>PGK</option>
<option>PHP</option>
<option>PKR</option>
<option>PLN</option>
<option>PYG</option>
<option>QAR</option>
<option>RON</option>
<option>RSD</option>
<option>RUB</option>
<option>RWF</option>
<option>SAR</option>
<option>SBD</option>
<option>SCR</option>
<option>SEK</option>
<option>SGD</option>
<option>SHP</option>
<option>SLL</option>
<option>SOS</option>
<option>SRD</option>
<option>STD</option>
<option>SZL</option>
<option>THB</option>
<option>TJS</option>
<option>TOP</option>
<option>TRY</option>
<option>TTD</option>
<option>TWD</option>
<option>TZS</option>
<option>UAH</option>
<option>UGX</option>
<option>UYU</option>
<option>UZS</option>
<option>VND</option>
<option>VUV</option>
<option>WST</option>
<option>XAF</option>
<option>XCD</option>
<option>XOF</option>
<option>XPF</option>
<option>YER</option>
<option>ZAR</option>
<option>ZMW</option>
</select></div>
</div>
<div class="simpay-form-control simpay-custom-amount-container">
<div class="simpay-custom-amount-label simpay-label-wrap"><label for="simpay-custom-amount-12110">Total Invoice Amount</label></div>
<div class="simpay-custom-amount-wrap simpay-field-wrap"><span class="simpay-currency-symbol simpay-currency-symbol-left">EUR</span><input id="simpay-custom-amount-12110" name="simpay_custom_amount"
class="simpay-amount-input simpay-custom-amount-input simpay-custom-amount-input-symbol-left simpay-input-error" type="tel" value=""></div>
</div>
<div class="simpay-form-control simpay-tax-amount-container">
<p class="simpay-total-amount-tax-label simpay-label-wrap">Transaction Fee (<span class="wpo-symbol">EUR</span>): <span class="simpay-tax-amount-value"> 0.00</span></p>
</div>
<div class="simpay-form-control simpay-total-amount-container">
<p class="simpay-total-amount-label simpay-label-wrap">Total Amount (<span class="wpo-symbol2">EUR</span>):<span class="simpay-total-amount-value"> 0.00</span></p>
</div>
<div class="simpay-form-control"><button id="simpay-12110-payment-button" class="simpay-btn simpay-payment-btn"><span>Pay with Card</span></button></div><input type="hidden" name="simpay_form_id" value="12110"><input type="hidden"
name="simpay_amount" value="0" class="simpay-amount">
<div class="simpay-errors" id="simpay-form-12110-error">The minimum amount allowed is 1.00</div><input type="hidden" name="simpay_tax_amount" value="0.00" class="simpay-tax-amount"><input type="hidden" id="_wpnonce" name="_wpnonce"
value="e4df7d62dd"><input type="hidden" name="_wp_http_referer" value="/ie/payment-center/">
</form>Text Content
Powered by Cookiebot
* Consent
* Details
* [#IABV2SETTINGS#]
* About
THIS WEBSITE USES COOKIES
We use cookies to personalise content and to analyse our traffic. We also share
information about your use of our site with our analytics partners who may
combine it with other information that you’ve provided to them or that they’ve
collected from your use of their services.
Consent Selection
Necessary
Preferences
Statistics
Marketing
Show details
* Necessary 26
Necessary cookies help make a website usable by enabling basic functions like
page navigation and access to secure areas of the website. The website cannot
function properly without these cookies.
* Cookiebot
2
Learn more about this provider
1.gifUsed to count the number of sessions to the website, necessary for
optimizing CMP product delivery.
Expiry: SessionType: Pixel
CookieConsentStores the user's cookie consent state for the current domain
Expiry: 1 yearType: HTTP
* Google
1
Learn more about this provider
_GRECAPTCHAPending
Expiry: 179 daysType: HTTP
* Hubspot
10
Learn more about this provider
rc::aThis cookie is used to distinguish between humans and bots. This is
beneficial for the website, in order to make valid reports on the use of
their website.
Expiry: PersistentType: HTML
rc::bThis cookie is used to distinguish between humans and bots.
Expiry: SessionType: HTML
rc::cThis cookie is used to distinguish between humans and bots.
Expiry: SessionType: HTML
rc::d-15#This cookie is used to distinguish between humans and bots.
Expiry: PersistentType: HTML
rc::fThis cookie is used to distinguish between humans and bots.
Expiry: PersistentType: HTML
__cf_bm [x3]This cookie is used to distinguish between humans and bots.
This is beneficial for the website, in order to make valid reports on the
use of their website.
Expiry: 0 dayType: HTTP
_cfuvid [x2]This cookie is a part of the services provided by Cloudflare -
Including load-balancing, deliverance of website content and serving DNS
connection for website operators.
Expiry: SessionType: HTTP
* Stripe
6
Learn more about this provider
mDetermines the device used to access the website. This allows the website
to be formatted accordingly.
Expiry: 399 daysType: HTTP
_abThis cookie is necessary for making credit card transactions on the
website. The service is provided by Stripe.com which allows online
transactions without storing any credit card information.
Expiry: SessionType: HTML
_mfThis cookie is necessary for making credit card transactions on the
website. The service is provided by Stripe.com which allows online
transactions without storing any credit card information.
Expiry: SessionType: HTML
idPending
Expiry: SessionType: HTML
__stripe_midThis cookie is necessary for making credit card transactions
on the website. The service is provided by Stripe.com which allows online
transactions without storing any credit card information.
Expiry: 1 yearType: HTTP
__stripe_sidThis cookie is necessary for making credit card transactions
on the website. The service is provided by Stripe.com which allows online
transactions without storing any credit card information.
Expiry: 0 dayType: HTTP
* leads-api.gonorth.io
1
X-Mapping-#Saves the address and port number of the web server that is
managing the session. Used to improve the website's performance security.
Expiry: SessionType: HTTP
* nr-data.net
sbi.co.in
2
JSESSIONID [x2]Preserves users states across page requests.
Expiry: SessionType: HTTP
* sbi.co.in
2
COOKIE_SUPPORTThis cookie determines whether the browser accepts cookies.
Expiry: 1 yearType: HTTP
TS#Used to ensure website security and fraud detection.
Expiry: SessionType: HTTP
* www.workplaceoptions.com
2
_wpfuuidRegisters a unique ID for the visitor in order for the website to
recognize the visitor upon re-entry.
Expiry: 11 yearsType: HTTP
wpEmojiSettingsSupportsThis cookie is part of a bundle of cookies which
serve the purpose of content delivery and presentation. The cookies keep
the correct state of font, blog/picture sliders, color themes and other
website settings.
Expiry: SessionType: HTML
* Preferences 5
Preference cookies enable a website to remember information that changes the
way the website behaves or looks, like your preferred language or the region
that you are in.
* Hubspot
1
Learn more about this provider
messagesUtkStores a unique ID string for each chat-box session. This
allows the website-support to see previous issues and reconnect with the
previous supporter.
Expiry: 179 daysType: HTTP
* sbi.co.in
1
GUEST_LANGUAGE_IDDetermines the preferred language of the visitor. Allows
the website to set the preferred language upon the visitor's re-entry.
Expiry: 1 yearType: HTTP
* www.workplaceoptions.com
3
last_pys_utm_campaignUsed to track visitors on multiple websites, in order
to present relevant advertisement based on the visitor's preferences.
Expiry: SessionType: HTTP
last_pys_utm_mediumUsed to track visitors on multiple websites, in order
to present relevant advertisement based on the visitor's preferences.
Expiry: SessionType: HTTP
wp-wpml_current_languageDesignates the country code that is calculated
based on the user's IP address. Used to determine what language should be
used for the visitor.
Expiry: SessionType: HTTP
* Statistics 37
Statistic cookies help website owners to understand how visitors interact
with websites by collecting and reporting information anonymously.
* Google
5
Learn more about this provider
collectUsed to send data to Google Analytics about the visitor's device
and behavior. Tracks the visitor across devices and marketing channels.
Expiry: SessionType: Pixel
_gaRegisters a unique ID that is used to generate statistical data on how
the visitor uses the website.
Expiry: 2 yearsType: HTTP
_ga_#Used by Google Analytics to collect data on the number of times a
user has visited the website as well as dates for the first and most
recent visit.
Expiry: 2 yearsType: HTTP
_gatUsed by Google Analytics to throttle request rate
Expiry: 0 dayType: HTTP
_gidRegisters a unique ID that is used to generate statistical data on how
the visitor uses the website.
Expiry: 0 dayType: HTTP
* Hubspot
4
Learn more about this provider
__hsscIdentifies if the cookie data needs to be updated in the visitor's
browser.
Expiry: 0 dayType: HTTP
__hssrcUsed to recognise the visitor's browser upon reentry on the
website.
Expiry: SessionType: HTTP
__hstcSets a unique ID for the session. This allows the website to obtain
data on visitor behaviour for statistical purposes.
Expiry: 179 daysType: HTTP
hubspotutkSets a unique ID for the session. This allows the website to
obtain data on visitor behaviour for statistical purposes.
Expiry: 179 daysType: HTTP
* Onclusive
1
Learn more about this provider
an_airpr_recent_visitRegisters statistical data on users' behaviour on the
website. Used for internal analytics by the website operator.
Expiry: 0 dayType: HTTP
* Stripe
1
Learn more about this provider
1Registers data on visitors' website-behaviour. This is used for internal
analysis and website optimization.
Expiry: SessionType: HTML
* YouTube
1
Learn more about this provider
yt-player-headers-readableUsed to determine the optimal video quality
based on the visitor's device and network settings.
Expiry: PersistentType: HTML
* cdn.callrail.com
9
calltrk-_gaThis cookie is necessary for the call-tracking functionality
used by the website operator – The cookie sets an ID for the specific
user, which allows the website's support team to recognize the user when
calling their support, as well as seeing the user’s navigation on the
website.
Expiry: PersistentType: HTML
calltrk-calltrk_landingThis cookie is necessary for the call-tracking
functionality used by the website operator – The cookie sets an ID for the
specific user, which allows the website's support team to recognize the
user when calling their support, as well as seeing the user’s navigation
on the website.
Expiry: PersistentType: HTML
calltrk-calltrk_referrerThis cookie is necessary for the call-tracking
functionality used by the website operator – The cookie sets an ID for the
specific user, which allows the website's support team to recognize the
user when calling their support, as well as seeing the user’s navigation
on the website.
Expiry: PersistentType: HTML
calltrk-calltrk_session_idThis cookie is necessary for the call-tracking
functionality used by the website operator – The cookie sets an ID for the
specific user, which allows the website's support team to recognize the
user when calling their support, as well as seeing the user’s navigation
on the website.
Expiry: PersistentType: HTML
calltrk_nearest_tld [x2]This cookie is necessary for the call-tracking
functionality used by the website operator – The cookie sets an ID for the
specific user, which allows the website's support team to recognize the
user when calling their support, as well as seeing the user’s navigation
on the website.
Expiry: 3599 daysType: HTTP
calltrk_landingThis cookie is necessary for the call-tracking
functionality used by the website operator – The cookie sets an ID for the
specific user, which allows the website's support team to recognize the
user when calling their support, as well as seeing the user’s navigation
on the website.
Expiry: 1 yearType: HTTP
calltrk_referrerThis cookie is necessary for the call-tracking
functionality used by the website operator – The cookie sets an ID for the
specific user, which allows the website's support team to recognize the
user when calling their support, as well as seeing the user’s navigation
on the website.
Expiry: 1 yearType: HTTP
calltrk_session_idThis cookie is necessary for the call-tracking
functionality used by the website operator – The cookie sets an ID for the
specific user, which allows the website's support team to recognize the
user when calling their support, as well as seeing the user’s navigation
on the website.
Expiry: 1 yearType: HTTP
* www.workplaceoptions.com
16
last_pys_landing_pageRegisters statistical data on users' behaviour on the
website. Used for internal analytics by the website operator.
Expiry: 6 daysType: HTTP
last_pysTrafficSourceRegisters statistical data on users' behaviour on the
website. Used for internal analytics by the website operator.
Expiry: 6 daysType: HTTP
pys_bingidRegisters statistical data on users' behaviour on the website.
Used for internal analytics by the website operator.
Expiry: SessionType: HTTP
pys_fbadidRegisters statistical data on users' behaviour on the website.
Used for internal analytics by the website operator.
Expiry: SessionType: HTTP
pys_first_visitRegisters statistical data on users' behaviour on the
website. Used for internal analytics by the website operator.
Expiry: 6 daysType: HTTP
pys_gadidRegisters statistical data on users' behaviour on the website.
Used for internal analytics by the website operator.
Expiry: SessionType: HTTP
pys_landing_pageDetects and stores which landing page was presented to the
user.
Expiry: 6 daysType: HTTP
pys_padidRegisters statistical data on users' behaviour on the website.
Used for internal analytics by the website operator.
Expiry: SessionType: HTTP
pys_session_limitRegisters statistical data on users' behaviour on the
website. Used for internal analytics by the website operator.
Expiry: 0 dayType: HTTP
pys_start_sessionRegisters statistical data on users' behaviour on the
website. Used for internal analytics by the website operator.
Expiry: SessionType: HTTP
pys_utm_campaignRegisters statistical data on users' behaviour on the
website. Used for internal analytics by the website operator.
Expiry: SessionType: HTTP
pys_utm_contentRegisters statistical data on users' behaviour on the
website. Used for internal analytics by the website operator.
Expiry: SessionType: HTTP
pys_utm_mediumRegisters statistical data on users' behaviour on the
website. Used for internal analytics by the website operator.
Expiry: SessionType: HTTP
pys_utm_sourceRegisters statistical data on users' behaviour on the
website. Used for internal analytics by the website operator.
Expiry: SessionType: HTTP
pys_utm_termRegisters statistical data on users' behaviour on the website.
Used for internal analytics by the website operator.
Expiry: SessionType: HTTP
pysTrafficSourceRegisters statistical data on users' behaviour on the
website. Used for internal analytics by the website operator.
Expiry: 6 daysType: HTTP
* Marketing 43
Marketing cookies are used to track visitors across websites. The intention
is to display ads that are relevant and engaging for the individual user and
thereby more valuable for publishers and third party advertisers.
* Appnexus
3
Learn more about this provider
receive-cookie-deprecationCollects information on user behaviour on
multiple websites. This information is used in order to optimize the
relevance of advertisement on the website.
Expiry: 399 daysType: HTTP
uuid2Registers a unique ID that identifies a returning user's device. The
ID is used for targeted ads.
Expiry: 3 monthsType: HTTP
XANDR_PANIDThis cookie registers data on the visitor. The information is
used to optimize advertisement relevance.
Expiry: 3 monthsType: HTTP
* Google
1
Learn more about this provider
NIDPending
Expiry: 6 monthsType: HTTP
* Hubspot
1
Learn more about this provider
__ptq.gifSends data to the marketing platform Hubspot about the visitor's
device and behaviour. Tracks the visitor across devices and marketing
channels.
Expiry: SessionType: Pixel
* YouTube
31
Learn more about this provider
#-# [x2]Pending
Expiry: SessionType: HTML
iU5q-!O9@[#COOKIETABLE_ADVERTISING#]nbsp;[x2]Registers a unique ID to keep
statistics of what videos from YouTube the user has seen.
Expiry: SessionType: HTML
LAST_RESULT_ENTRY_KEY [x2]Used to track user’s interaction with embedded
content.
Expiry: SessionType: HTTP
nextId [x2]Used to track user’s interaction with embedded content.
Expiry: SessionType: HTTP
requests [x2]Used to track user’s interaction with embedded content.
Expiry: SessionType: HTTP
TESTCOOKIESENABLED [x2]Used to track user’s interaction with embedded
content.
Expiry: 0 dayType: HTTP
yt.innertube::nextId [x2]Registers a unique ID to keep statistics of what
videos from YouTube the user has seen.
Expiry: PersistentType: HTML
yt.innertube::requestsRegisters a unique ID to keep statistics of what
videos from YouTube the user has seen.
Expiry: PersistentType: HTML
ytidb::LAST_RESULT_ENTRY_KEYUsed to track user’s interaction with embedded
content.
Expiry: PersistentType: HTML
YtIdbMeta#databases [x2]Used to track user’s interaction with embedded
content.
Expiry: PersistentType: IDB
LogsDatabaseV2:V#||LogsRequestsStorePending
Expiry: PersistentType: IDB
PREFRegisters a unique ID that is used by Google to keep statistics of how
the visitor uses YouTube videos across different websites.
Expiry: 8 monthsType: HTTP
remote_sidNecessary for the implementation and functionality of YouTube
video-content on the website.
Expiry: SessionType: HTTP
ServiceWorkerLogsDatabase#SWHealthLogNecessary for the implementation and
functionality of YouTube video-content on the website.
Expiry: PersistentType: IDB
VISITOR_INFO1_LIVETries to estimate the users' bandwidth on pages with
integrated YouTube videos.
Expiry: 179 daysType: HTTP
YSCRegisters a unique ID to keep statistics of what videos from YouTube
the user has seen.
Expiry: SessionType: HTTP
yt-remote-cast-availableStores the user's video player preferences using
embedded YouTube video
Expiry: SessionType: HTML
yt-remote-cast-installedStores the user's video player preferences using
embedded YouTube video
Expiry: SessionType: HTML
yt-remote-connected-devicesStores the user's video player preferences
using embedded YouTube video
Expiry: PersistentType: HTML
yt-remote-device-idStores the user's video player preferences using
embedded YouTube video
Expiry: PersistentType: HTML
yt-remote-fast-check-periodStores the user's video player preferences
using embedded YouTube video
Expiry: SessionType: HTML
yt-remote-session-appStores the user's video player preferences using
embedded YouTube video
Expiry: SessionType: HTML
yt-remote-session-nameStores the user's video player preferences using
embedded YouTube video
Expiry: SessionType: HTML
* www.workplaceoptions.com
7
last_pys_bingidUsed to track visitors on multiple websites, in order to
present relevant advertisement based on the visitor's preferences.
Expiry: SessionType: HTTP
last_pys_fbadidUsed to track visitors on multiple websites, in order to
present relevant advertisement based on the visitor's preferences.
Expiry: SessionType: HTTP
last_pys_gadidUsed to track visitors on multiple websites, in order to
present relevant advertisement based on the visitor's preferences.
Expiry: SessionType: HTTP
last_pys_padidUsed to track visitors on multiple websites, in order to
present relevant advertisement based on the visitor's preferences.
Expiry: SessionType: HTTP
last_pys_utm_contentUsed to track visitors on multiple websites, in order
to present relevant advertisement based on the visitor's preferences.
Expiry: SessionType: HTTP
last_pys_utm_sourceUsed to track visitors on multiple websites, in order
to present relevant advertisement based on the visitor's preferences.
Expiry: SessionType: HTTP
last_pys_utm_termUsed to track visitors on multiple websites, in order to
present relevant advertisement based on the visitor's preferences.
Expiry: SessionType: HTTP
* Unclassified 6
Unclassified cookies are cookies that we are in the process of classifying,
together with the providers of individual cookies.
* Rackspace
3
Learn more about this provider
__apex_test__Pending
Expiry: SessionType: HTTP
lead_cd_tokenPending
Expiry: 499 daysType: HTTP
lead_session_uuidPending
Expiry: 499 daysType: HTTP
* cdn.callrail.com
1
calltrk-integration-data-ttlPending
Expiry: PersistentType: HTML
* sbi.co.in
1
SwaraPending
Expiry: SessionType: HTTP
* www.workplaceoptions.com
1
wp-api-schema-modelhttps://#.#/#/Pending
Expiry: SessionType: HTML
Cross-domain consent[#BULK_CONSENT_DOMAINS_COUNT#] [#BULK_CONSENT_TITLE#]
List of domains your consent applies to: [#BULK_CONSENT_DOMAINS#]
Cookie declaration last updated on 7/6/24 by Cookiebot
[#IABV2_TITLE#]
[#IABV2_BODY_INTRO#]
[#IABV2_BODY_LEGITIMATE_INTEREST_INTRO#]
[#IABV2_BODY_PREFERENCE_INTRO#]
[#IABV2_LABEL_PURPOSES#]
[#IABV2_BODY_PURPOSES_INTRO#]
[#IABV2_BODY_PURPOSES#]
[#IABV2_LABEL_FEATURES#]
[#IABV2_BODY_FEATURES_INTRO#]
[#IABV2_BODY_FEATURES#]
[#IABV2_LABEL_PARTNERS#]
[#IABV2_BODY_PARTNERS_INTRO#]
[#IABV2_BODY_PARTNERS#]
Cookies are small text files that can be used by websites to make a user's
experience more efficient.
The law states that we can store cookies on your device if they are strictly
necessary for the operation of this site. For all other types of cookies we need
your permission.
This site uses different types of cookies. Some cookies are placed by third
party services that appear on our pages.
You can at any time change or withdraw your consent from the Cookie Declaration
on our website.
Learn more about who we are, how you can contact us and how we process personal
data in our Privacy Policy.
Please state your consent ID and date when you contact us regarding your
consent.
Do not sell or share my personal information
Use necessary cookies only Allow Selected/Close Customize
Select all cookies
Powered by Cookiebot by Usercentrics
*
* English
*
Login
MEMBERS
CUSTOMER HUB
LOCAL SERVICE PARTNERS
YOUR MEMBER BENEFITS WEBSITE FEATURES INCLUDE:
* Access to online articles with helpful information
* Ability to submit an online form asking a counsellor to contact you
* Topics covering working life, wellness, parenting, management, etc.
YOUR CUSTOMER HUB FEATURES INCLUDE:
* Automated headcount updates in UCMS
* Invoicing reflective of the active populations under your account
* Access reporting with case trends, disruptive issues, use
LOCAL SERVICE PARTNERS
Local Service Partners are independent EAPs with which WPO has established
strategic relationships for the delivery of global EAP services in alignment
with the WPO models, processes and quality standards.
Members Login
Customer Hub Login
Become a WPO Partner
* About Us
* Organisation
* Commitment
* Our Global Impact
* Why choose WPO?
* Wellbeing Solutions
* Emotional Support
* Physical Support
* Practical Support
* Organisational Effectiveness
* Individual Effectiveness
* Digital Solutions
* Case Management and Reporting
* Consulting
* Resources
* Mental Health Resources
* Case Studies
* White Papers
* Videos
* Infographics
* News & Media
* News
* Blogs
* Podcasts
* Events
* Careers
Login
*
* English
*
Contact
Login
1. Home >
2. Payment Center >
United States
Canada
Mexico
United Kingdom
Ireland
Portugal
France
Belgium
Germany
United Arab Emirates
India
China
Singapore
Indonesia
Australia
Uruguay
WPO PAYMENT CENTER
Welcome to the Workplace Options payment center. Get the Employee Assistance
Program (EAP) services you need, when you need them most by paying through our
easy to use credit card payment option. Its fast, convenient and secure.
WORKPLACE OPTIONS LTD (IRELAND)
Invoice#
Company Name
Choose Currency
USDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBIFBMDBNDBOBBRLBSDBWPBZDCADCDFCHFCLPCNYCOPCRCCVECZKDJFDKKDOPDZDEGPETBEURFJDFKPGBPGELGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSINRISKJMDJPYKESKGSKHRKMFKRWKYDKZTLAKLBPLKRLRDLSLMADMDLMGAMKDMMKMNTMOPMROMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSEKSGDSHPSLLSOSSRDSTDSZLTHBTJSTOPTRYTTDTWDTZSUAHUGXUYUUZSVNDVUVWSTXAFXCDXOFXPFYERZARZMW
Total Invoice Amount
EUR
Transaction Fee (EUR): 0.00
Total Amount (EUR): 0.00
Pay with Card
The minimum amount allowed is 1.00
HERE’S HOW TO SUBMIT YOUR PAYMENT:
* – Start by adding your invoice # and company name.
* – Next choose the currency type. You can simply use – the drop-down menu and
choose your currency type and hit enter.
* – Enter in the amount of the invoice. This amount should match the invoice.
* – Our system will automatically calculate your payment in your local
currency.
* – A local transaction fee will automatically be added for all payments.
* – Next click the payment button.
* – Enter your enter your payment choice, billing address and submit.
* – You will automatically receive an email notification that your payment has
been made.
For questions or issues related to payments, please contact:
WPOPaymentCenterQueries@workplaceoptions.com
SECURITY AND COMPLIANCE
We use a third party payment processor (Stripe) to process payments made to us
through this website. In connection with the processing of such payments, we do
not retain any personally identifiable information or any financial information
such as credit card numbers.
PRIVACY POLICY
All personal identifiable information or financial information is provided
directly to our third party processor, Stripe, whose use of your personal
information is governed by their privacy policy, which may be viewed at
www.stripe.com/us/privacy.
Read Our Terms And Conditions
Workplace Options is the world's largest independent wellbeing solutions leader
that supports individuals to become healthier, happier and more productive.
* About Workplace Options
* Wellbeing Solutions
* Resources
* News & Media
* Careers
* Contact Us
* Privacy Policy
* Terms of Use
* Member Website
* Customer Hub
* Local Service Partner
* Consulting
* Contact Us
* +353-012612726
* Workplace Options
Block 6, Belfield Office Park, Clonskeagh, Dublin 4,
Ireland.
PAYMENTS
Payment Center
FOLLOW US
*
*
*
*
*
© 2024 Workplace Options. All Rights Reserved