www.workplaceoptions.com
Open in
urlscan Pro
103.72.76.87
Public Scan
URL:
https://www.workplaceoptions.com/ie/payment-center/
Submission: On June 08 via manual from SG — Scanned from SG
Submission: On June 08 via manual from SG — Scanned from SG
Form analysis
9 forms found in the DOM<form>
<fieldset>
<legend class="visuallyhidden">Consent Selection</legend>
<div id="CybotCookiebotDialogBodyFieldsetInnerContainer">
<div class="CybotCookiebotDialogBodyLevelButtonWrapper"><label class="CybotCookiebotDialogBodyLevelButtonLabel" for="CybotCookiebotDialogBodyLevelButtonNecessary"><strong
class="CybotCookiebotDialogBodyLevelButtonDescription">Necessary</strong></label>
<div class="CybotCookiebotDialogBodyLevelButtonSliderWrapper CybotCookiebotDialogBodyLevelButtonSliderWrapperDisabled"><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonNecessary"
class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelButtonDisabled" disabled="disabled" checked="checked"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></div>
</div>
<div class="CybotCookiebotDialogBodyLevelButtonWrapper"><label class="CybotCookiebotDialogBodyLevelButtonLabel" for="CybotCookiebotDialogBodyLevelButtonPreferences"><strong
class="CybotCookiebotDialogBodyLevelButtonDescription">Preferences</strong></label>
<div class="CybotCookiebotDialogBodyLevelButtonSliderWrapper"><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonPreferences" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox"
data-target="CybotCookiebotDialogBodyLevelButtonPreferencesInline" checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></div>
</div>
<div class="CybotCookiebotDialogBodyLevelButtonWrapper"><label class="CybotCookiebotDialogBodyLevelButtonLabel" for="CybotCookiebotDialogBodyLevelButtonStatistics"><strong
class="CybotCookiebotDialogBodyLevelButtonDescription">Statistics</strong></label>
<div class="CybotCookiebotDialogBodyLevelButtonSliderWrapper"><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonStatistics" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox"
data-target="CybotCookiebotDialogBodyLevelButtonStatisticsInline" checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></div>
</div>
<div class="CybotCookiebotDialogBodyLevelButtonWrapper"><label class="CybotCookiebotDialogBodyLevelButtonLabel" for="CybotCookiebotDialogBodyLevelButtonMarketing"><strong
class="CybotCookiebotDialogBodyLevelButtonDescription">Marketing</strong></label>
<div class="CybotCookiebotDialogBodyLevelButtonSliderWrapper"><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonMarketing" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox"
data-target="CybotCookiebotDialogBodyLevelButtonMarketingInline" checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></div>
</div>
</div>
</fieldset>
</form>
<form><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonNecessaryInline" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelButtonDisabled" disabled="disabled" checked="checked"> <span
class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form>
<form><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonPreferencesInline" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox" data-target="CybotCookiebotDialogBodyLevelButtonPreferences"
checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form>
<form><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonStatisticsInline" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox" data-target="CybotCookiebotDialogBodyLevelButtonStatistics"
checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form>
<form><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonMarketingInline" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox" data-target="CybotCookiebotDialogBodyLevelButtonMarketing" checked="checked"
tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form>
<form class="CybotCookiebotDialogBodyLevelButtonSliderWrapper"><input type="checkbox" id="CybotCookiebotDialogBodyContentCheckboxPersonalInformation" class="CybotCookiebotDialogBodyLevelButton"> <span
class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form>
GET https://www.workplaceoptions.com/ie/
<form class="glbl_form" id="hdr_srch" role="search" method="get" action="https://www.workplaceoptions.com/ie/">
<div class="srch_box_mob">
<input type="text" placeholder="Search..." value="" name="s" required="">
<button class="serch_btn" type="submit"> <img src="https://www.workplaceoptions.com/ie/wp-content/themes/wpo/images/Icon-map-search.png" alt=""></button><button>
</button>
</div>
</form>
GET https://www.workplaceoptions.com/ie/
<form class="glbl_form" id="hdr_srch_mob" role="search" method="get" action="https://www.workplaceoptions.com/ie/">
<div class="srch_box_mob">
<input type="text" placeholder="Search...." value="" name="s" required="">
<button class="serch_btn" type="submit"> <img src="https://www.workplaceoptions.com/ie/wp-content/themes/wpo/images/Icon-map-search.png" alt=""></button><button>
</button>
</div>
</form>
POST
<form action="" method="post" class="simpay-checkout-form simpay-form-12110 simpay-checkout-form--stripe_checkout" id="simpay-form-12110" data-simpay-form-id="12110" data-simpay-form-instance="0">
<div class="simpay-form-control simpay-text-container">
<div class="simpay-text-label simpay-label-wrap"><label for="simpay-12110-text-2">Invoice#</label></div>
<div class="simpay-text-wrap simpay-field-wrap"><input type="text" name="simpay_field[Invoice#]" id="simpay-12110-text-2" placeholder="" value="" required="" maxlength="500"> </div>
</div>
<div class="simpay-form-control simpay-text-container">
<div class="simpay-text-label simpay-label-wrap"><label for="simpay-12110-text-3">Company Name</label></div>
<div class="simpay-text-wrap simpay-field-wrap"><input type="text" name="simpay_field[Company Name]" id="simpay-12110-text-3" placeholder="" value="" required="" maxlength="500"> </div>
</div>
<div class="simpay-form-control simpay-dropdown-container">
<div class="simpay-dropdown-label simpay-label-wrap"><label for="simpay-12110-dropdown-4">Choose Currency</label></div>
<div class="simpay-dropdown-wrap simpay-field-wrap"><select name="simpay_field[cur]" id="simpay-12110-dropdown-4" required=""""">
<option>USD</option>
<option>AED</option>
<option>AFN</option>
<option>ALL</option>
<option>AMD</option>
<option>ANG</option>
<option>AOA</option>
<option>ARS</option>
<option>AUD</option>
<option>AWG</option>
<option>AZN</option>
<option>BAM</option>
<option>BBD</option>
<option>BDT</option>
<option>BGN</option>
<option>BIF</option>
<option>BMD</option>
<option>BND</option>
<option>BOB</option>
<option>BRL</option>
<option>BSD</option>
<option>BWP</option>
<option>BZD</option>
<option>CAD</option>
<option>CDF</option>
<option>CHF</option>
<option>CLP</option>
<option>CNY</option>
<option>COP</option>
<option>CRC</option>
<option>CVE</option>
<option>CZK</option>
<option>DJF</option>
<option>DKK</option>
<option>DOP</option>
<option>DZD</option>
<option>EGP</option>
<option>ETB</option>
<option selected="selected">EUR</option>
<option>FJD</option>
<option>FKP</option>
<option>GBP</option>
<option>GEL</option>
<option>GIP</option>
<option>GMD</option>
<option>GNF</option>
<option>GTQ</option>
<option>GYD</option>
<option>HKD</option>
<option>HNL</option>
<option>HRK</option>
<option>HTG</option>
<option>HUF</option>
<option>IDR</option>
<option>ILS</option>
<option>INR</option>
<option>ISK</option>
<option>JMD</option>
<option>JPY</option>
<option>KES</option>
<option>KGS</option>
<option>KHR</option>
<option>KMF</option>
<option>KRW</option>
<option>KYD</option>
<option>KZT</option>
<option>LAK</option>
<option>LBP</option>
<option>LKR</option>
<option>LRD</option>
<option>LSL</option>
<option>MAD</option>
<option>MDL</option>
<option>MGA</option>
<option>MKD</option>
<option>MMK</option>
<option>MNT</option>
<option>MOP</option>
<option>MRO</option>
<option>MUR</option>
<option>MVR</option>
<option>MWK</option>
<option>MXN</option>
<option>MYR</option>
<option>MZN</option>
<option>NAD</option>
<option>NGN</option>
<option>NIO</option>
<option>NOK</option>
<option>NPR</option>
<option>NZD</option>
<option>PAB</option>
<option>PEN</option>
<option>PGK</option>
<option>PHP</option>
<option>PKR</option>
<option>PLN</option>
<option>PYG</option>
<option>QAR</option>
<option>RON</option>
<option>RSD</option>
<option>RUB</option>
<option>RWF</option>
<option>SAR</option>
<option>SBD</option>
<option>SCR</option>
<option>SEK</option>
<option>SGD</option>
<option>SHP</option>
<option>SLL</option>
<option>SOS</option>
<option>SRD</option>
<option>STD</option>
<option>SZL</option>
<option>THB</option>
<option>TJS</option>
<option>TOP</option>
<option>TRY</option>
<option>TTD</option>
<option>TWD</option>
<option>TZS</option>
<option>UAH</option>
<option>UGX</option>
<option>UYU</option>
<option>UZS</option>
<option>VND</option>
<option>VUV</option>
<option>WST</option>
<option>XAF</option>
<option>XCD</option>
<option>XOF</option>
<option>XPF</option>
<option>YER</option>
<option>ZAR</option>
<option>ZMW</option>
</select></div>
</div>
<div class="simpay-form-control simpay-custom-amount-container">
<div class="simpay-custom-amount-label simpay-label-wrap"><label for="simpay-custom-amount-12110">Total Invoice Amount</label></div>
<div class="simpay-custom-amount-wrap simpay-field-wrap"><span class="simpay-currency-symbol simpay-currency-symbol-left">EUR</span><input id="simpay-custom-amount-12110" name="simpay_custom_amount"
class="simpay-amount-input simpay-custom-amount-input simpay-custom-amount-input-symbol-left simpay-input-error" type="tel" value=""></div>
</div>
<div class="simpay-form-control simpay-tax-amount-container">
<p class="simpay-total-amount-tax-label simpay-label-wrap">Transaction Fee (<span class="wpo-symbol">EUR</span>): <span class="simpay-tax-amount-value"> 0.00</span></p>
</div>
<div class="simpay-form-control simpay-total-amount-container">
<p class="simpay-total-amount-label simpay-label-wrap">Total Amount (<span class="wpo-symbol2">EUR</span>):<span class="simpay-total-amount-value"> 0.00</span></p>
</div>
<div class="simpay-form-control"><button id="simpay-12110-payment-button" class="simpay-btn simpay-payment-btn"><span>Pay with Card</span></button></div><input type="hidden" name="simpay_form_id" value="12110"><input type="hidden"
name="simpay_amount" value="0" class="simpay-amount">
<div class="simpay-errors" id="simpay-form-12110-error">The minimum amount allowed is 1.00</div><input type="hidden" name="simpay_tax_amount" value="0.00" class="simpay-tax-amount"><input type="hidden" id="_wpnonce" name="_wpnonce"
value="e4df7d62dd"><input type="hidden" name="_wp_http_referer" value="/ie/payment-center/">
</form>
Text Content
Powered by Cookiebot * Consent * Details * [#IABV2SETTINGS#] * About THIS WEBSITE USES COOKIES We use cookies to personalise content and to analyse our traffic. We also share information about your use of our site with our analytics partners who may combine it with other information that you’ve provided to them or that they’ve collected from your use of their services. Consent Selection Necessary Preferences Statistics Marketing Show details * Necessary 26 Necessary cookies help make a website usable by enabling basic functions like page navigation and access to secure areas of the website. The website cannot function properly without these cookies. * Cookiebot 2 Learn more about this provider 1.gifUsed to count the number of sessions to the website, necessary for optimizing CMP product delivery. Expiry: SessionType: Pixel CookieConsentStores the user's cookie consent state for the current domain Expiry: 1 yearType: HTTP * Google 1 Learn more about this provider _GRECAPTCHAPending Expiry: 179 daysType: HTTP * Hubspot 10 Learn more about this provider rc::aThis cookie is used to distinguish between humans and bots. This is beneficial for the website, in order to make valid reports on the use of their website. Expiry: PersistentType: HTML rc::bThis cookie is used to distinguish between humans and bots. Expiry: SessionType: HTML rc::cThis cookie is used to distinguish between humans and bots. Expiry: SessionType: HTML rc::d-15#This cookie is used to distinguish between humans and bots. Expiry: PersistentType: HTML rc::fThis cookie is used to distinguish between humans and bots. Expiry: PersistentType: HTML __cf_bm [x3]This cookie is used to distinguish between humans and bots. This is beneficial for the website, in order to make valid reports on the use of their website. Expiry: 0 dayType: HTTP _cfuvid [x2]This cookie is a part of the services provided by Cloudflare - Including load-balancing, deliverance of website content and serving DNS connection for website operators. Expiry: SessionType: HTTP * Stripe 6 Learn more about this provider mDetermines the device used to access the website. This allows the website to be formatted accordingly. Expiry: 399 daysType: HTTP _abThis cookie is necessary for making credit card transactions on the website. The service is provided by Stripe.com which allows online transactions without storing any credit card information. Expiry: SessionType: HTML _mfThis cookie is necessary for making credit card transactions on the website. The service is provided by Stripe.com which allows online transactions without storing any credit card information. Expiry: SessionType: HTML idPending Expiry: SessionType: HTML __stripe_midThis cookie is necessary for making credit card transactions on the website. The service is provided by Stripe.com which allows online transactions without storing any credit card information. Expiry: 1 yearType: HTTP __stripe_sidThis cookie is necessary for making credit card transactions on the website. The service is provided by Stripe.com which allows online transactions without storing any credit card information. Expiry: 0 dayType: HTTP * leads-api.gonorth.io 1 X-Mapping-#Saves the address and port number of the web server that is managing the session. Used to improve the website's performance security. Expiry: SessionType: HTTP * nr-data.net sbi.co.in 2 JSESSIONID [x2]Preserves users states across page requests. Expiry: SessionType: HTTP * sbi.co.in 2 COOKIE_SUPPORTThis cookie determines whether the browser accepts cookies. Expiry: 1 yearType: HTTP TS#Used to ensure website security and fraud detection. Expiry: SessionType: HTTP * www.workplaceoptions.com 2 _wpfuuidRegisters a unique ID for the visitor in order for the website to recognize the visitor upon re-entry. Expiry: 11 yearsType: HTTP wpEmojiSettingsSupportsThis cookie is part of a bundle of cookies which serve the purpose of content delivery and presentation. The cookies keep the correct state of font, blog/picture sliders, color themes and other website settings. Expiry: SessionType: HTML * Preferences 5 Preference cookies enable a website to remember information that changes the way the website behaves or looks, like your preferred language or the region that you are in. * Hubspot 1 Learn more about this provider messagesUtkStores a unique ID string for each chat-box session. This allows the website-support to see previous issues and reconnect with the previous supporter. Expiry: 179 daysType: HTTP * sbi.co.in 1 GUEST_LANGUAGE_IDDetermines the preferred language of the visitor. Allows the website to set the preferred language upon the visitor's re-entry. Expiry: 1 yearType: HTTP * www.workplaceoptions.com 3 last_pys_utm_campaignUsed to track visitors on multiple websites, in order to present relevant advertisement based on the visitor's preferences. Expiry: SessionType: HTTP last_pys_utm_mediumUsed to track visitors on multiple websites, in order to present relevant advertisement based on the visitor's preferences. Expiry: SessionType: HTTP wp-wpml_current_languageDesignates the country code that is calculated based on the user's IP address. Used to determine what language should be used for the visitor. Expiry: SessionType: HTTP * Statistics 37 Statistic cookies help website owners to understand how visitors interact with websites by collecting and reporting information anonymously. * Google 5 Learn more about this provider collectUsed to send data to Google Analytics about the visitor's device and behavior. Tracks the visitor across devices and marketing channels. Expiry: SessionType: Pixel _gaRegisters a unique ID that is used to generate statistical data on how the visitor uses the website. Expiry: 2 yearsType: HTTP _ga_#Used by Google Analytics to collect data on the number of times a user has visited the website as well as dates for the first and most recent visit. Expiry: 2 yearsType: HTTP _gatUsed by Google Analytics to throttle request rate Expiry: 0 dayType: HTTP _gidRegisters a unique ID that is used to generate statistical data on how the visitor uses the website. Expiry: 0 dayType: HTTP * Hubspot 4 Learn more about this provider __hsscIdentifies if the cookie data needs to be updated in the visitor's browser. Expiry: 0 dayType: HTTP __hssrcUsed to recognise the visitor's browser upon reentry on the website. Expiry: SessionType: HTTP __hstcSets a unique ID for the session. This allows the website to obtain data on visitor behaviour for statistical purposes. Expiry: 179 daysType: HTTP hubspotutkSets a unique ID for the session. This allows the website to obtain data on visitor behaviour for statistical purposes. Expiry: 179 daysType: HTTP * Onclusive 1 Learn more about this provider an_airpr_recent_visitRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: 0 dayType: HTTP * Stripe 1 Learn more about this provider 1Registers data on visitors' website-behaviour. This is used for internal analysis and website optimization. Expiry: SessionType: HTML * YouTube 1 Learn more about this provider yt-player-headers-readableUsed to determine the optimal video quality based on the visitor's device and network settings. Expiry: PersistentType: HTML * cdn.callrail.com 9 calltrk-_gaThis cookie is necessary for the call-tracking functionality used by the website operator – The cookie sets an ID for the specific user, which allows the website's support team to recognize the user when calling their support, as well as seeing the user’s navigation on the website. Expiry: PersistentType: HTML calltrk-calltrk_landingThis cookie is necessary for the call-tracking functionality used by the website operator – The cookie sets an ID for the specific user, which allows the website's support team to recognize the user when calling their support, as well as seeing the user’s navigation on the website. Expiry: PersistentType: HTML calltrk-calltrk_referrerThis cookie is necessary for the call-tracking functionality used by the website operator – The cookie sets an ID for the specific user, which allows the website's support team to recognize the user when calling their support, as well as seeing the user’s navigation on the website. Expiry: PersistentType: HTML calltrk-calltrk_session_idThis cookie is necessary for the call-tracking functionality used by the website operator – The cookie sets an ID for the specific user, which allows the website's support team to recognize the user when calling their support, as well as seeing the user’s navigation on the website. Expiry: PersistentType: HTML calltrk_nearest_tld [x2]This cookie is necessary for the call-tracking functionality used by the website operator – The cookie sets an ID for the specific user, which allows the website's support team to recognize the user when calling their support, as well as seeing the user’s navigation on the website. Expiry: 3599 daysType: HTTP calltrk_landingThis cookie is necessary for the call-tracking functionality used by the website operator – The cookie sets an ID for the specific user, which allows the website's support team to recognize the user when calling their support, as well as seeing the user’s navigation on the website. Expiry: 1 yearType: HTTP calltrk_referrerThis cookie is necessary for the call-tracking functionality used by the website operator – The cookie sets an ID for the specific user, which allows the website's support team to recognize the user when calling their support, as well as seeing the user’s navigation on the website. Expiry: 1 yearType: HTTP calltrk_session_idThis cookie is necessary for the call-tracking functionality used by the website operator – The cookie sets an ID for the specific user, which allows the website's support team to recognize the user when calling their support, as well as seeing the user’s navigation on the website. Expiry: 1 yearType: HTTP * www.workplaceoptions.com 16 last_pys_landing_pageRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: 6 daysType: HTTP last_pysTrafficSourceRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: 6 daysType: HTTP pys_bingidRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: SessionType: HTTP pys_fbadidRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: SessionType: HTTP pys_first_visitRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: 6 daysType: HTTP pys_gadidRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: SessionType: HTTP pys_landing_pageDetects and stores which landing page was presented to the user. Expiry: 6 daysType: HTTP pys_padidRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: SessionType: HTTP pys_session_limitRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: 0 dayType: HTTP pys_start_sessionRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: SessionType: HTTP pys_utm_campaignRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: SessionType: HTTP pys_utm_contentRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: SessionType: HTTP pys_utm_mediumRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: SessionType: HTTP pys_utm_sourceRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: SessionType: HTTP pys_utm_termRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: SessionType: HTTP pysTrafficSourceRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: 6 daysType: HTTP * Marketing 43 Marketing cookies are used to track visitors across websites. The intention is to display ads that are relevant and engaging for the individual user and thereby more valuable for publishers and third party advertisers. * Appnexus 3 Learn more about this provider receive-cookie-deprecationCollects information on user behaviour on multiple websites. This information is used in order to optimize the relevance of advertisement on the website. Expiry: 399 daysType: HTTP uuid2Registers a unique ID that identifies a returning user's device. The ID is used for targeted ads. Expiry: 3 monthsType: HTTP XANDR_PANIDThis cookie registers data on the visitor. The information is used to optimize advertisement relevance. Expiry: 3 monthsType: HTTP * Google 1 Learn more about this provider NIDPending Expiry: 6 monthsType: HTTP * Hubspot 1 Learn more about this provider __ptq.gifSends data to the marketing platform Hubspot about the visitor's device and behaviour. Tracks the visitor across devices and marketing channels. Expiry: SessionType: Pixel * YouTube 31 Learn more about this provider #-# [x2]Pending Expiry: SessionType: HTML iU5q-!O9@[#COOKIETABLE_ADVERTISING#]nbsp;[x2]Registers a unique ID to keep statistics of what videos from YouTube the user has seen. Expiry: SessionType: HTML LAST_RESULT_ENTRY_KEY [x2]Used to track user’s interaction with embedded content. Expiry: SessionType: HTTP nextId [x2]Used to track user’s interaction with embedded content. Expiry: SessionType: HTTP requests [x2]Used to track user’s interaction with embedded content. Expiry: SessionType: HTTP TESTCOOKIESENABLED [x2]Used to track user’s interaction with embedded content. Expiry: 0 dayType: HTTP yt.innertube::nextId [x2]Registers a unique ID to keep statistics of what videos from YouTube the user has seen. Expiry: PersistentType: HTML yt.innertube::requestsRegisters a unique ID to keep statistics of what videos from YouTube the user has seen. Expiry: PersistentType: HTML ytidb::LAST_RESULT_ENTRY_KEYUsed to track user’s interaction with embedded content. Expiry: PersistentType: HTML YtIdbMeta#databases [x2]Used to track user’s interaction with embedded content. Expiry: PersistentType: IDB LogsDatabaseV2:V#||LogsRequestsStorePending Expiry: PersistentType: IDB PREFRegisters a unique ID that is used by Google to keep statistics of how the visitor uses YouTube videos across different websites. Expiry: 8 monthsType: HTTP remote_sidNecessary for the implementation and functionality of YouTube video-content on the website. Expiry: SessionType: HTTP ServiceWorkerLogsDatabase#SWHealthLogNecessary for the implementation and functionality of YouTube video-content on the website. Expiry: PersistentType: IDB VISITOR_INFO1_LIVETries to estimate the users' bandwidth on pages with integrated YouTube videos. Expiry: 179 daysType: HTTP YSCRegisters a unique ID to keep statistics of what videos from YouTube the user has seen. Expiry: SessionType: HTTP yt-remote-cast-availableStores the user's video player preferences using embedded YouTube video Expiry: SessionType: HTML yt-remote-cast-installedStores the user's video player preferences using embedded YouTube video Expiry: SessionType: HTML yt-remote-connected-devicesStores the user's video player preferences using embedded YouTube video Expiry: PersistentType: HTML yt-remote-device-idStores the user's video player preferences using embedded YouTube video Expiry: PersistentType: HTML yt-remote-fast-check-periodStores the user's video player preferences using embedded YouTube video Expiry: SessionType: HTML yt-remote-session-appStores the user's video player preferences using embedded YouTube video Expiry: SessionType: HTML yt-remote-session-nameStores the user's video player preferences using embedded YouTube video Expiry: SessionType: HTML * www.workplaceoptions.com 7 last_pys_bingidUsed to track visitors on multiple websites, in order to present relevant advertisement based on the visitor's preferences. Expiry: SessionType: HTTP last_pys_fbadidUsed to track visitors on multiple websites, in order to present relevant advertisement based on the visitor's preferences. Expiry: SessionType: HTTP last_pys_gadidUsed to track visitors on multiple websites, in order to present relevant advertisement based on the visitor's preferences. Expiry: SessionType: HTTP last_pys_padidUsed to track visitors on multiple websites, in order to present relevant advertisement based on the visitor's preferences. Expiry: SessionType: HTTP last_pys_utm_contentUsed to track visitors on multiple websites, in order to present relevant advertisement based on the visitor's preferences. Expiry: SessionType: HTTP last_pys_utm_sourceUsed to track visitors on multiple websites, in order to present relevant advertisement based on the visitor's preferences. Expiry: SessionType: HTTP last_pys_utm_termUsed to track visitors on multiple websites, in order to present relevant advertisement based on the visitor's preferences. Expiry: SessionType: HTTP * Unclassified 6 Unclassified cookies are cookies that we are in the process of classifying, together with the providers of individual cookies. * Rackspace 3 Learn more about this provider __apex_test__Pending Expiry: SessionType: HTTP lead_cd_tokenPending Expiry: 499 daysType: HTTP lead_session_uuidPending Expiry: 499 daysType: HTTP * cdn.callrail.com 1 calltrk-integration-data-ttlPending Expiry: PersistentType: HTML * sbi.co.in 1 SwaraPending Expiry: SessionType: HTTP * www.workplaceoptions.com 1 wp-api-schema-modelhttps://#.#/#/Pending Expiry: SessionType: HTML Cross-domain consent[#BULK_CONSENT_DOMAINS_COUNT#] [#BULK_CONSENT_TITLE#] List of domains your consent applies to: [#BULK_CONSENT_DOMAINS#] Cookie declaration last updated on 7/6/24 by Cookiebot [#IABV2_TITLE#] [#IABV2_BODY_INTRO#] [#IABV2_BODY_LEGITIMATE_INTEREST_INTRO#] [#IABV2_BODY_PREFERENCE_INTRO#] [#IABV2_LABEL_PURPOSES#] [#IABV2_BODY_PURPOSES_INTRO#] [#IABV2_BODY_PURPOSES#] [#IABV2_LABEL_FEATURES#] [#IABV2_BODY_FEATURES_INTRO#] [#IABV2_BODY_FEATURES#] [#IABV2_LABEL_PARTNERS#] [#IABV2_BODY_PARTNERS_INTRO#] [#IABV2_BODY_PARTNERS#] Cookies are small text files that can be used by websites to make a user's experience more efficient. The law states that we can store cookies on your device if they are strictly necessary for the operation of this site. For all other types of cookies we need your permission. This site uses different types of cookies. Some cookies are placed by third party services that appear on our pages. You can at any time change or withdraw your consent from the Cookie Declaration on our website. Learn more about who we are, how you can contact us and how we process personal data in our Privacy Policy. Please state your consent ID and date when you contact us regarding your consent. Do not sell or share my personal information Use necessary cookies only Allow Selected/Close Customize Select all cookies Powered by Cookiebot by Usercentrics * * English * Login MEMBERS CUSTOMER HUB LOCAL SERVICE PARTNERS YOUR MEMBER BENEFITS WEBSITE FEATURES INCLUDE: * Access to online articles with helpful information * Ability to submit an online form asking a counsellor to contact you * Topics covering working life, wellness, parenting, management, etc. YOUR CUSTOMER HUB FEATURES INCLUDE: * Automated headcount updates in UCMS * Invoicing reflective of the active populations under your account * Access reporting with case trends, disruptive issues, use LOCAL SERVICE PARTNERS Local Service Partners are independent EAPs with which WPO has established strategic relationships for the delivery of global EAP services in alignment with the WPO models, processes and quality standards. Members Login Customer Hub Login Become a WPO Partner * About Us * Organisation * Commitment * Our Global Impact * Why choose WPO? * Wellbeing Solutions * Emotional Support * Physical Support * Practical Support * Organisational Effectiveness * Individual Effectiveness * Digital Solutions * Case Management and Reporting * Consulting * Resources * Mental Health Resources * Case Studies * White Papers * Videos * Infographics * News & Media * News * Blogs * Podcasts * Events * Careers Login * * English * Contact Login 1. Home > 2. Payment Center > United States Canada Mexico United Kingdom Ireland Portugal France Belgium Germany United Arab Emirates India China Singapore Indonesia Australia Uruguay WPO PAYMENT CENTER Welcome to the Workplace Options payment center. Get the Employee Assistance Program (EAP) services you need, when you need them most by paying through our easy to use credit card payment option. Its fast, convenient and secure. WORKPLACE OPTIONS LTD (IRELAND) Invoice# Company Name Choose Currency USDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBIFBMDBNDBOBBRLBSDBWPBZDCADCDFCHFCLPCNYCOPCRCCVECZKDJFDKKDOPDZDEGPETBEURFJDFKPGBPGELGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSINRISKJMDJPYKESKGSKHRKMFKRWKYDKZTLAKLBPLKRLRDLSLMADMDLMGAMKDMMKMNTMOPMROMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSEKSGDSHPSLLSOSSRDSTDSZLTHBTJSTOPTRYTTDTWDTZSUAHUGXUYUUZSVNDVUVWSTXAFXCDXOFXPFYERZARZMW Total Invoice Amount EUR Transaction Fee (EUR): 0.00 Total Amount (EUR): 0.00 Pay with Card The minimum amount allowed is 1.00 HERE’S HOW TO SUBMIT YOUR PAYMENT: * – Start by adding your invoice # and company name. * – Next choose the currency type. You can simply use – the drop-down menu and choose your currency type and hit enter. * – Enter in the amount of the invoice. This amount should match the invoice. * – Our system will automatically calculate your payment in your local currency. * – A local transaction fee will automatically be added for all payments. * – Next click the payment button. * – Enter your enter your payment choice, billing address and submit. * – You will automatically receive an email notification that your payment has been made. For questions or issues related to payments, please contact: WPOPaymentCenterQueries@workplaceoptions.com SECURITY AND COMPLIANCE We use a third party payment processor (Stripe) to process payments made to us through this website. In connection with the processing of such payments, we do not retain any personally identifiable information or any financial information such as credit card numbers. PRIVACY POLICY All personal identifiable information or financial information is provided directly to our third party processor, Stripe, whose use of your personal information is governed by their privacy policy, which may be viewed at www.stripe.com/us/privacy. Read Our Terms And Conditions Workplace Options is the world's largest independent wellbeing solutions leader that supports individuals to become healthier, happier and more productive. * About Workplace Options * Wellbeing Solutions * Resources * News & Media * Careers * Contact Us * Privacy Policy * Terms of Use * Member Website * Customer Hub * Local Service Partner * Consulting * Contact Us * +353-012612726 * Workplace Options Block 6, Belfield Office Park, Clonskeagh, Dublin 4, Ireland. PAYMENTS Payment Center FOLLOW US * * * * * © 2024 Workplace Options. All Rights Reserved