Submitted URL: http://events.bizzabo.com/
Effective URL: https://www.bizzabo.com/
Submission: On November 23 via manual from PH — Scanned from DE

Summary

This website contacted 4 IPs in 1 countries across 3 domains to perform 86 HTTP transactions. The main IP is 2606:4700::6812:1734, located in United States and belongs to CLOUDFLARENET, US. The main domain is www.bizzabo.com. The Cisco Umbrella rank of the primary domain is 752349.
TLS certificate: Issued by GTS CA 1P5 on October 16th 2023. Valid for: 3 months.
This is the only time www.bizzabo.com was scanned on urlscan.io!

urlscan.io Verdict: No classification

Domain & IP information

IP Address AS Autonomous System
2 2 100.25.85.188 14618 (AMAZON-AES)
2 86 2606:4700::68... 13335 (CLOUDFLAR...)
1 2606:4700::68... 13335 (CLOUDFLAR...)
1 2606:4700::68... 13335 (CLOUDFLAR...)
86 4
Apex Domain
Subdomains
Transfer
88 bizzabo.com
events.bizzabo.com — Cisco Umbrella Rank: 214830
www.bizzabo.com — Cisco Umbrella Rank: 752349
bizzabo.com — Cisco Umbrella Rank: 52893
1 MB
1 jsdelivr.net
cdn.jsdelivr.net — Cisco Umbrella Rank: 335
2 KB
1 cloudflareinsights.com
static.cloudflareinsights.com — Cisco Umbrella Rank: 899
7 KB
86 3
Domain Requested by
85 www.bizzabo.com 1 redirects www.bizzabo.com
static.cloudflareinsights.com
2 events.bizzabo.com 2 redirects
1 bizzabo.com 1 redirects
1 cdn.jsdelivr.net www.bizzabo.com
1 static.cloudflareinsights.com www.bizzabo.com
86 5
Subject Issuer Validity Valid
bizzabo.com
GTS CA 1P5
2023-10-16 -
2024-01-14
3 months crt.sh
sni.cloudflaressl.com
Cloudflare Inc ECC CA-3
2023-04-10 -
2024-04-09
a year crt.sh

This page contains 2 frames:

Primary Page: https://www.bizzabo.com/
Frame ID: C57A05F1108532CB3662C0F03855E82F
Requests: 88 HTTP requests in this frame

Frame: https://www.bizzabo.com/cdn-cgi/challenge-platform/h/g/scripts/jsd/9914b343/main.js
Frame ID: 3451B84C8C24F5B3C15BEC9E976BAC96
Requests: 2 HTTP requests in this frame

Screenshot

Page Title

#1 Event Management Software for B2B Conferences | Bizzaboclosearrow-circle-o-downchevron-downtwitterfacebooklinkedinangle-downellipsis-vinstagrammagnifiercrossarrow-defualtplaypause

Page URL History Show full URLs

  1. http://events.bizzabo.com/ HTTP 301
    https://events.bizzabo.com/ HTTP 301
    https://www.bizzabo.com/ Page URL

Detected technologies

Overall confidence: 100%
Detected patterns
  • /wp-(?:content|includes)/

Overall confidence: 100%
Detected patterns
  • wp-content/plugins/oxygen

Overall confidence: 100%
Detected patterns
  • static\.cloudflareinsights\.com/beacon(?:\.min)?\.js

Overall confidence: 100%
Detected patterns
  • /flickity(?:\.pkgd)?(?:\.min)?\.js

Overall confidence: 100%
Detected patterns
  • jquery.*\.js(?:\?ver(?:sion)?=([\d.]+))?

Overall confidence: 100%
Detected patterns
  • //cdn\.jsdelivr\.net/

Page Statistics

86
Requests

98 %
HTTPS

75 %
IPv6

3
Domains

5
Subdomains

4
IPs

1
Countries

1322 kB
Transfer

3953 kB
Size

4
Cookies

Page URL History

This captures the URL locations of the websites, including HTTP redirects and client-side redirects via JavaScript or Meta fields.

  1. http://events.bizzabo.com/ HTTP 301
    https://events.bizzabo.com/ HTTP 301
    https://www.bizzabo.com/ Page URL

Redirected requests

There were HTTP redirect chains for the following requests:

Request Chain 66
  • https://www.bizzabo.com/cdn-cgi/challenge-platform/scripts/jsd/main.js HTTP 302
  • https://www.bizzabo.com/cdn-cgi/challenge-platform/h/g/scripts/jsd/9914b343/main.js
Request Chain 88
  • https://bizzabo.com/wp-content/uploads/2023/02/1-thumbnail.png HTTP 301
  • https://www.bizzabo.com/wp-content/uploads/2023/02/1-thumbnail.png

86 HTTP transactions

Resource
Path
Size
x-fer
Type
MIME-Type
Primary Request /
www.bizzabo.com/
Redirect Chain
  • http://events.bizzabo.com/
  • https://events.bizzabo.com/
  • https://www.bizzabo.com/
300 KB
49 KB
Document
General
Full URL
https://www.bizzabo.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
4903810ed0efa24035b61925dd458e3f91c7b62429927279b93d8cfe073b95c9
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Upgrade-Insecure-Requests
1
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36
accept-language
de-DE,de;q=0.9

Response headers

alt-svc
h3=":443"; ma=86400
cache-control
max-age=0
cf-cache-status
DYNAMIC
cf-ray
82a643139c1c9963-FRA
content-encoding
gzip
content-type
text/html; charset=UTF-8
date
Thu, 23 Nov 2023 03:17:56 GMT
expires
Thu, 23 Nov 2023 03:17:56 GMT
host-header
6b7412fb82ca5edfd0917e3957f05d89
last-modified
Wed, 22 Nov 2023 19:09:10 GMT
server
cloudflare
strict-transport-security
max-age=31536000; includeSubDomains; preload
vary
Accept-Encoding Accept-Encoding
x-content-type-options
nosniff
x-frame-options
SAMEORIGIN
x-httpd-modphp
1
x-proxy-cache
MISS
x-proxy-cache-info
0 NC:000000 UP:

Redirect headers

cache-control
no-cache
content-length
102
content-type
text/html; charset=utf-8
date
Thu, 23 Nov 2023 03:17:56 GMT
expires
Thu, 23 Nov 2023 03:17:55 GMT
location
https://www.bizzabo.com
referrer-policy
strict-origin-when-cross-origin
server
nginx
server-timing
intid;desc=18bf38c167711e95
strict-transport-security
max-age=31536000; includeSubDomains
vary
Accept, Accept-Encoding
x-content-type-options
nosniff
x-xss-protection
0
ma_customfonts.css
www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/fonts/
13 KB
973 B
Stylesheet
General
Full URL
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/fonts/ma_customfonts.css?ver=1700680149
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
e1b65e283b0916083e20dcf6a3171e13a39d6bc851a9e5a2f72f0d83fafed75a
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Wed, 22 Nov 2023 19:09:09 GMT
server
cloudflare
etag
W/"655e51d5-35ae"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
text/css
cache-control
max-age=31536000
cf-ray
82a64316cd649963-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
style.min.css
www.bizzabo.com/wp-includes/css/dist/block-library/
107 KB
18 KB
Stylesheet
General
Full URL
https://www.bizzabo.com/wp-includes/css/dist/block-library/style.min.css?ver=6.4.1
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
698b89c0da3d319754d6a837b5e6d4e6a42dc402d9ffd7559b8c4cb29c644340
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 09 Nov 2023 11:38:14 GMT
server
cloudflare
etag
W/"654cc4a6-1add3"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
text/css
cache-control
max-age=31536000
cf-ray
82a64316cd659963-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
blocks.style.build.css
www.bizzabo.com/wp-content/cache/min/1/wp-content/plugins/embedpress/Gutenberg/dist/
30 KB
7 KB
Stylesheet
General
Full URL
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/plugins/embedpress/Gutenberg/dist/blocks.style.build.css?ver=1700680149
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
e7f425a708d6b10329b0f55dc049429956a6b06e117d3f130cb7a0e4f3935587
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Wed, 22 Nov 2023 19:09:09 GMT
server
cloudflare
etag
W/"655e51d5-7778"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
text/css
cache-control
max-age=31536000
cf-ray
82a64316cd669963-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
embedpress.css
www.bizzabo.com/wp-content/cache/min/1/wp-content/plugins/embedpress/assets/css/
30 KB
7 KB
Stylesheet
General
Full URL
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/plugins/embedpress/assets/css/embedpress.css?ver=1700680149
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
83fcde39691e8276b0a2f67389e805f44a14095d0af70bf7950297ccccf6fdc7
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Wed, 22 Nov 2023 19:09:09 GMT
server
cloudflare
etag
W/"655e51d5-77ac"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
text/css
cache-control
max-age=31536000
cf-ray
82a64316cd689963-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
oxygen.css
www.bizzabo.com/wp-content/cache/min/1/wp-content/plugins/oxygen/component-framework/
17 KB
5 KB
Stylesheet
General
Full URL
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/plugins/oxygen/component-framework/oxygen.css?ver=1700680149
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
4b88774bf01b457774c28ca71e9272eec9d31780a7fbc7555e0900d657dfe48f
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Wed, 22 Nov 2023 19:09:09 GMT
server
cloudflare
etag
W/"655e51d5-43de"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
text/css
cache-control
max-age=31536000
cf-ray
82a64316cd6a9963-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
plyr.css
www.bizzabo.com/wp-content/cache/min/1/wp-content/plugins/embedpress/assets/css/
32 KB
7 KB
Stylesheet
General
Full URL
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/plugins/embedpress/assets/css/plyr.css?ver=1700680149
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
c06593065d525cac7ffb626221f4edad2e94791edd7c71bb8573c3600567cb19
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Wed, 22 Nov 2023 19:09:09 GMT
server
cloudflare
etag
W/"655e51d5-7ef3"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
text/css
cache-control
max-age=31536000
cf-ray
82a64316dd729963-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
jquery.min.js
www.bizzabo.com/wp-includes/js/jquery/
86 KB
35 KB
Script
General
Full URL
https://www.bizzabo.com/wp-includes/js/jquery/jquery.min.js?ver=3.7.1
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
cb6f2d32c49d1c2b25e9ffc9aaafa3f83075346c01bcd4ae6eb187392a4292cf
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 09 Nov 2023 11:38:14 GMT
server
cloudflare
etag
W/"654cc4a6-15601"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643170d8b9963-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
plyr.polyfilled.js
www.bizzabo.com/wp-content/plugins/embedpress/assets/js/
117 KB
41 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/embedpress/assets/js/plyr.polyfilled.js?ver=1
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
57ff88bcf73a9a1211529bbab1275b88f0a645549b655fdcec74666feb1aaa3d
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Wed, 18 Oct 2023 11:39:44 GMT
server
cloudflare
etag
W/"652fc400-1d44b"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643170d8d9963-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
16264.css
www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/oxygen/css/
1 KB
607 B
Stylesheet
General
Full URL
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/oxygen/css/16264.css?ver=1700680149
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
ffa879e9152c1ef634a6372e138b5850d7224703521e5367dbb58d7d19004e4a
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Wed, 22 Nov 2023 19:09:09 GMT
server
cloudflare
etag
W/"655e51d5-5a6"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
text/css
cache-control
max-age=31536000
cf-ray
82a64316fd7e9963-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
739.css
www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/oxygen/css/
18 KB
3 KB
Stylesheet
General
Full URL
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/oxygen/css/739.css?ver=1700680149
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
6e80a05e1dd91e8a0871023366a1ad4064b5fdfafdbd1789d7d41259c7edbfb3
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Wed, 22 Nov 2023 19:09:09 GMT
server
cloudflare
etag
W/"655e51d5-4842"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
text/css
cache-control
max-age=31536000
cf-ray
82a64316fd7f9963-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
738.css
www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/oxygen/css/
54 KB
9 KB
Stylesheet
General
Full URL
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/oxygen/css/738.css?ver=1700680149
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
dd8ffc8fe022556186baedcf4c4c4a10ffd4f903dfac4928308e157d482e4840
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Wed, 22 Nov 2023 19:09:09 GMT
server
cloudflare
etag
W/"655e51d5-d62a"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
text/css
cache-control
max-age=31536000
cf-ray
82a64316fd809963-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
8.css
www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/oxygen/css/
516 B
307 B
Stylesheet
General
Full URL
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/oxygen/css/8.css?ver=1700680149
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
2978f180b2a34e9104c011584035f4474e6bf6c2bb84d0b7563a578f3faa6ce5
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Wed, 22 Nov 2023 19:09:09 GMT
server
cloudflare
etag
W/"655e51d5-204"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
text/css
cache-control
max-age=31536000
cf-ray
82a64316fd819963-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
17929.css
www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/oxygen/css/
63 KB
10 KB
Stylesheet
General
Full URL
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/oxygen/css/17929.css?ver=1700680150
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
41ab7e97544508d53304ec5049b1b77c7671e234ba6c88fb81bf4da5764f47b3
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Wed, 22 Nov 2023 19:09:10 GMT
server
cloudflare
etag
W/"655e51d6-fbdd"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
text/css
cache-control
max-age=31536000
cf-ray
82a643170d899963-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
universal.css
www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/oxygen/css/
291 KB
58 KB
Stylesheet
General
Full URL
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/oxygen/css/universal.css?ver=1700680149
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
cb842e19a0ff4bfc03a3ee9b9b218ef37adfa05516d5fe9c2ef1529f5b043c49
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Wed, 22 Nov 2023 19:09:09 GMT
server
cloudflare
etag
W/"655e51d5-48ae8"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
text/css
cache-control
max-age=31536000
cf-ray
82a643170d8a9963-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
truncated
/
64 B
0
Image
General
Full URL
data:truncated
Protocol
DATA
Server
-, , ASN (),
Reverse DNS
Software
/
Resource Hash
b6dcc1490a0cc33cdeed8970677b89bbec6fa095675af198b8e923b64563c70a

Request headers

accept-language
de-DE,de;q=0.9
Referer
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Content-Type
image/svg+xml
truncated
/
66 B
0
Image
General
Full URL
data:truncated
Protocol
DATA
Server
-, , ASN (),
Reverse DNS
Software
/
Resource Hash
b06a486bb2416641154f1a27fc10562d68f6ceebf0c52f399843421b10219b8a

Request headers

accept-language
de-DE,de;q=0.9
Referer
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Content-Type
image/svg+xml
truncated
/
66 B
0
Image
General
Full URL
data:truncated
Protocol
DATA
Server
-, , ASN (),
Reverse DNS
Software
/
Resource Hash
804149656daaee610e0c38b7139e94bfcaf69f1b13a33b99f35494db855cce03

Request headers

accept-language
de-DE,de;q=0.9
Referer
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Content-Type
image/svg+xml
aos.css
www.bizzabo.com/wp-content/cache/min/1/wp-content/plugins/oxygen/component-framework/vendor/aos/
25 KB
3 KB
Stylesheet
General
Full URL
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/plugins/oxygen/component-framework/vendor/aos/aos.css?ver=1700680149
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
1aa8845fd06e475aefe733d4e55b36a92fcd487975049c8172341827ac9cc03e
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Wed, 22 Nov 2023 19:09:09 GMT
server
cloudflare
etag
W/"655e51d5-65c5"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
text/css
cache-control
max-age=31536000
cf-ray
82a643176d3d65d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
pdfobject.min.js
www.bizzabo.com/wp-content/plugins/embedpress/assets/js/
13 KB
5 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/embedpress/assets/js/pdfobject.min.js?ver=3.9.0
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
3a3fcee601e829af094ce197af4a7e839296ac3a944dd8f6673997586c57a385
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Wed, 18 Oct 2023 11:39:44 GMT
server
cloudflare
etag
W/"652fc400-34ee"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643177d4065d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
initplyr.js
www.bizzabo.com/wp-content/plugins/embedpress/assets/js/
9 KB
3 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/embedpress/assets/js/initplyr.js?ver=3.9.0
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
cbef33084dd0de133e8d0c2d2588eae77f386cb638f443b67640f18e23b0dae0
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Wed, 18 Oct 2023 11:39:44 GMT
server
cloudflare
etag
W/"652fc400-232b"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643177d4365d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
front.js
www.bizzabo.com/wp-content/plugins/embedpress/assets/js/
20 KB
6 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/embedpress/assets/js/front.js?ver=3.9.0
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
8f13c7600f9f1d9e0f396719a3465c24fac9a908cd81cfa2abb2d286b6349c72
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Wed, 18 Oct 2023 11:39:44 GMT
server
cloudflare
etag
W/"652fc400-50fb"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643177d4465d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
documents-viewer-script.js
www.bizzabo.com/wp-content/plugins/embedpress/assets/js/
10 KB
3 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/embedpress/assets/js/documents-viewer-script.js?ver=3.9.0
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
c3dc83cc4fb3fc6535c5e5fb061fc5ea193f7ff61c5e8f539f76c68b42d80a40
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Wed, 18 Oct 2023 11:39:44 GMT
server
cloudflare
etag
W/"652fc400-299f"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643177d4565d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
aos.js
www.bizzabo.com/wp-content/plugins/oxygen/component-framework/vendor/aos/
14 KB
5 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxygen/component-framework/vendor/aos/aos.js?ver=1
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
4460f1596174d06cca957fdaca2c71e1a377cf1d6f07ee4c75ffb3bf3fc97a03
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 09 Nov 2023 11:58:02 GMT
server
cloudflare
etag
W/"654cc94a-37a3"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643177d4665d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
accessible-megamenu.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/
51 KB
12 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/accessible-megamenu.js?ver=1.0.0
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
0abfb5e0ee261e593ff1cfa355872dac2330c87e8f5c36d83f6d88a59b7acb5c
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-cc7d"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643177d4765d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
megamenu-init.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/
14 KB
4 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/megamenu-init.js?ver=1.0.2
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
43a16a98029fbf464ae55da9e8b53e3dbe1de587d35d32cc3485f38e795ae514
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-39cd"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643177d4865d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
inert.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/
27 KB
8 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/inert.js?ver=1.0.0
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
c0cc75c6c4b1c5b0a6ed8152f1d14ec8ac779e901bec739e6b9913f38045dd5b
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-6ad0"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643177d4965d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
offcanvas-init.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/
12 KB
3 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/offcanvas-init.js?ver=1.0.3
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
4e437f16f727fdedafd28880302a629d040344e452decb4afed8d7bfd934d076
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-2ef3"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643177d4a65d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
vime.esm.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
13 KB
4 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/vime.esm.js?ver=4.7.3
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
9e7f09bbad88f3369693ab0653640d3e9de1988036e9676627e5ab83d4ebec78
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-325e"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643177d4c65d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
flickity.pkgd.min.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/flickity/
53 KB
17 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/flickity/flickity.pkgd.min.js?ver=2.2.1
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
dcc6aaeccd530bcb0e91ef01e2046485f1ad113a865aafb17a740eee4da61e32
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-d32f"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643177d4d65d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
intersectionobserver.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/
29 KB
10 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/intersectionobserver.js?ver=1.0.0
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
36765572da8f1a28f7916e6ab8ca524b9434998a807098b185ec15e843bb48ae
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-7474"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643177d4e65d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
countUp.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/
11 KB
3 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/countUp.js?ver=2.0.5
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
f8a39bafdb655139dd18cd344b43d758f1acbb3da1e482edb9967fc47d45722f
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-2a37"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643177d4f65d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
gridbuildersupport.js
www.bizzabo.com/wp-content/plugins/oxyextras/includes/js/
1 KB
677 B
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/includes/js/gridbuildersupport.js?ver=1.0.1
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
5103a8458588b0955f21354969656831b499020028124a8a6f8495220c459b2f
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-47b"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643177d5065d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
flickity-init-4.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/flickity/
19 KB
5 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/flickity/flickity-init-4.js?ver=2.3.1
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
8568348024e4c657c95d237b9a22eec68d5fe609a82b27ef201781825991df43
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-4a2e"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643177d5165d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
lazyload.min.js
www.bizzabo.com/wp-content/plugins/wp-rocket/assets/js/lazyload/17.8.3/
9 KB
4 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/wp-rocket/assets/js/lazyload/17.8.3/lazyload.min.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
f40767552e5e94b2d5f9a65d7f640cfa7d225298023dbd682095e040809a3d1a
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Wed, 08 Nov 2023 14:11:23 GMT
server
cloudflare
etag
W/"654b970b-22bc"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643177d5265d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
v84a3a4012de94ce1a686ba8c167c359c1696973893317
static.cloudflareinsights.com/beacon.min.js/
20 KB
7 KB
Script
General
Full URL
https://static.cloudflareinsights.com/beacon.min.js/v84a3a4012de94ce1a686ba8c167c359c1696973893317
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2606:4700::6810:3965 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
6153d13804862b0fc1c016cf1129f34cb7c6185f2cf4bf1a3a862eecdab50101

Request headers

Referer
https://www.bizzabo.com/
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
last-modified
Tue, 10 Oct 2023 21:38:13 GMT
server
cloudflare
etag
W/"2023.10.0"
vary
Accept-Encoding
content-type
text/javascript;charset=UTF-8
access-control-allow-origin
*
cache-control
public, max-age=86400
cross-origin-resource-policy
cross-origin
cf-ray
82a64317fadb7188-FRA
truncated
/
546 B
0
Image
General
Full URL
data:truncated
Protocol
DATA
Server
-, , ASN (),
Reverse DNS
Software
/
Resource Hash
185fbe0a2f69df1ffc2585e724f8a42a643311c2d03274f2b583fc1cf1305b08

Request headers

accept-language
de-DE,de;q=0.9
Referer
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

Content-Type
image/svg+xml
new-badge.svg
www.bizzabo.com/wp-content/uploads/2023/07/
604 B
1 KB
Image
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2023/07/new-badge.svg
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/oxygen/css/universal.css?ver=1700680149
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
be6daa8d39cc542a1ae7c45e998fe4aa4cab4f5371d7c90180d3f522ecda74b0
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/oxygen/css/universal.css?ver=1700680149
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
content-security-policy-report-only
script-src 'none'; report-uri https://csp-reporting.cloudflare.com/cdn-cgi/script_monitor/report?m=.aDpvCKMTBHVqCcN3S5S2P7YMKoQkjYSfKF0RIhavkg-1700709477-0-AUysMwgl4BxTeoe4btoShMZjwuxpMbDhw-vtgYpQbcGLPgtMrBKZ8z-cjGMX84MhOHBIeBTYh_KLztkTljsiUZ95pjUPZgS1dJ7TdQK3L3bFNIVqWs0Vlqqd_tzliLQKwJYZYFCsaoNi2edXWvnBphI; report-to cf-csp-endpoint
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 20 Jul 2023 14:09:43 GMT
server
cloudflare
etag
W/"64b94027-25c"
vary
Accept-Encoding
report-to
{"endpoints":[{"url":"https:\/\/csp-reporting.cloudflare.com\/cdn-cgi\/script_monitor\/report?m=.aDpvCKMTBHVqCcN3S5S2P7YMKoQkjYSfKF0RIhavkg-1700709477-0-AUysMwgl4BxTeoe4btoShMZjwuxpMbDhw-vtgYpQbcGLPgtMrBKZ8z-cjGMX84MhOHBIeBTYh_KLztkTljsiUZ95pjUPZgS1dJ7TdQK3L3bFNIVqWs0Vlqqd_tzliLQKwJYZYFCsaoNi2edXWvnBphI"}],"group":"cf-csp-endpoint","max_age":86400}
content-type
image/svg+xml
x-frame-options
SAMEORIGIN
cache-control
max-age=31536000
cf-ray
82a6431b0f9f65d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
icon.svg
www.bizzabo.com/wp-content/uploads/2023/01/
485 B
619 B
Image
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2023/01/icon.svg
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/oxygen/css/universal.css?ver=1700680149
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
28284879b097fbde1e0c0b8df6e70e2583546a210601de686892c72013079c89
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/oxygen/css/universal.css?ver=1700680149
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:10 GMT
server
cloudflare
etag
W/"642e7cbe-1e5"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
image/svg+xml
cache-control
max-age=31536000
cf-ray
82a6431b0fa365d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
none
www.bizzabo.com/wp-content/uploads/oxygen/css/
29 KB
29 KB
Image
General
Full URL
https://www.bizzabo.com/wp-content/uploads/oxygen/css/none
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/oxygen/css/17929.css?ver=1700680150
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
1a712d047786843523787fa06add5e3cb8e472b42802a86fd30a0cc76a1a28e4
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/oxygen/css/17929.css?ver=1700680150
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

x-proxy-cache
MISS
date
Thu, 23 Nov 2023 03:17:58 GMT
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
content-encoding
gzip
x-proxy-cache-info
0 NC:000000 UP:
x-httpd-modphp
1
host-header
6b7412fb82ca5edfd0917e3957f05d89
alt-svc
h3=":443"; ma=86400
server
cloudflare
vary
Accept-Encoding, Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
text/html; charset=UTF-8
cache-control
no-cache, must-revalidate, max-age=0
cf-ray
82a6431b1fa865d6-FRA
link
<https://www.bizzabo.com/wp-json/>; rel="https://api.w.org/"
expires
Wed, 11 Jan 1984 05:00:00 GMT
RealTextPro-Light.ttf
www.bizzabo.com/wp-content/uploads/fonts/RealTextPro/
193 KB
94 KB
Font
General
Full URL
https://www.bizzabo.com/wp-content/uploads/fonts/RealTextPro/RealTextPro-Light.ttf
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/fonts/ma_customfonts.css?ver=1700680149
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
86d07304b5448b8d833eb9784882f3ae420a9db068a94b0efd3cf01ca8a7b8e9
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/fonts/ma_customfonts.css?ver=1700680149
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:09 GMT
server
cloudflare
etag
W/"642e7cbd-30230"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/x-font-ttf
cache-control
max-age=31536000
cf-ray
82a6431b1fab65d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
RealTextPro-Medium.ttf
www.bizzabo.com/wp-content/uploads/fonts/RealTextPro/
208 KB
98 KB
Font
General
Full URL
https://www.bizzabo.com/wp-content/uploads/fonts/RealTextPro/RealTextPro-Medium.ttf
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/fonts/ma_customfonts.css?ver=1700680149
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
231a4a0964642a40a28219ebf3e49dd487725dc52a0f52c69b7e5755ad7525e9
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/fonts/ma_customfonts.css?ver=1700680149
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:09 GMT
server
cloudflare
etag
W/"642e7cbd-33eac"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/x-font-ttf
cache-control
max-age=31536000
cf-ray
82a6431b1fac65d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
Real%20Text%20Regular.otf
www.bizzabo.com/wp-content/uploads/fonts/RealTextPro/
222 KB
111 KB
Font
General
Full URL
https://www.bizzabo.com/wp-content/uploads/fonts/RealTextPro/Real%20Text%20Regular.otf
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/fonts/ma_customfonts.css?ver=1700680149
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
8f5384b507899fc0857ee0a35a9a33cd4b4ebd2cd56c2c70bacc8bdf752467eb
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/fonts/ma_customfonts.css?ver=1700680149
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
content-security-policy-report-only
script-src 'none'; report-uri https://csp-reporting.cloudflare.com/cdn-cgi/script_monitor/report?m=HwQBZQPyTfRLF6lS9tLEkDgZanWOk9iQPckFokWzxng-1700709477-0-AYvLE9jOJwCc7NMkaCKgBZw1kvNt_SoUEMlE2agIxhxw9FnCIV8Ib9hip0usXyGvCiBd9DF8Dt-5uwrTIOVGvzL6Vui_RXww9jQkK8OHQ9uk-TG-ohQe0mKoyzyIHJrGMvCfITzwM0suLoGq7mBQLuU; report-to cf-csp-endpoint
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:09 GMT
server
cloudflare
etag
W/"642e7cbd-376f0"
vary
Accept-Encoding
report-to
{"endpoints":[{"url":"https:\/\/csp-reporting.cloudflare.com\/cdn-cgi\/script_monitor\/report?m=HwQBZQPyTfRLF6lS9tLEkDgZanWOk9iQPckFokWzxng-1700709477-0-AYvLE9jOJwCc7NMkaCKgBZw1kvNt_SoUEMlE2agIxhxw9FnCIV8Ib9hip0usXyGvCiBd9DF8Dt-5uwrTIOVGvzL6Vui_RXww9jQkK8OHQ9uk-TG-ohQe0mKoyzyIHJrGMvCfITzwM0suLoGq7mBQLuU"}],"group":"cf-csp-endpoint","max_age":86400}
content-type
font/opentype
x-frame-options
SAMEORIGIN
cache-control
max-age=31536000
cf-ray
82a6431b1fad65d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
Real%20Text%20Semilight.otf
www.bizzabo.com/wp-content/uploads/fonts/RealTextPro/
223 KB
111 KB
Font
General
Full URL
https://www.bizzabo.com/wp-content/uploads/fonts/RealTextPro/Real%20Text%20Semilight.otf
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/fonts/ma_customfonts.css?ver=1700680149
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
9780582ea70694f58b9ec5183e3b2bdb7ee9ab4681757f4516044117fcaa11e4
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/fonts/ma_customfonts.css?ver=1700680149
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:09 GMT
server
cloudflare
etag
W/"642e7cbd-37d1c"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
font/opentype
cache-control
max-age=31536000
cf-ray
82a6431b1faf65d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
RealTextPro-Regular.ttf
www.bizzabo.com/wp-content/uploads/fonts/RealTextPro/
202 KB
96 KB
Font
General
Full URL
https://www.bizzabo.com/wp-content/uploads/fonts/RealTextPro/RealTextPro-Regular.ttf
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/fonts/ma_customfonts.css?ver=1700680149
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
0a412d0f7e0623e74dc3f737a9fd85e360e1c48c31c92eeaea907a281e0fa267
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/fonts/ma_customfonts.css?ver=1700680149
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:09 GMT
server
cloudflare
etag
W/"642e7cbd-329ac"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/x-font-ttf
cache-control
max-age=31536000
cf-ray
82a6431b1fb265d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
GalaxieCopernicus-Book.woff2
www.bizzabo.com/wp-content/uploads/fonts/Galaxie/
65 KB
66 KB
Font
General
Full URL
https://www.bizzabo.com/wp-content/uploads/fonts/Galaxie/GalaxieCopernicus-Book.woff2
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/fonts/ma_customfonts.css?ver=1700680149
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
2af8c8bfb3ad0be9f898c40578ffd61330efd9ddad54260988946bc2e94e9ff1
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/fonts/ma_customfonts.css?ver=1700680149
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
content-length
66880
last-modified
Thu, 06 Apr 2023 08:03:09 GMT
server
cloudflare
etag
"642e7cbd-10540"
x-frame-options
SAMEORIGIN
content-type
font/woff2
cache-control
max-age=31536000
accept-ranges
bytes
cf-ray
82a6431b1fb365d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
RealTextPro-Extralight.ttf
www.bizzabo.com/wp-content/uploads/fonts/RealTextPro/
190 KB
93 KB
Font
General
Full URL
https://www.bizzabo.com/wp-content/uploads/fonts/RealTextPro/RealTextPro-Extralight.ttf
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/fonts/ma_customfonts.css?ver=1700680149
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
fe97db18bfc54d9acdd5af63f23857cd7105e5ab8d4b1c8add8065767d4ab4d1
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/cache/min/1/wp-content/uploads/fonts/ma_customfonts.css?ver=1700680149
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:09 GMT
server
cloudflare
etag
W/"642e7cbd-2f884"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/x-font-ttf
cache-control
max-age=31536000
cf-ray
82a6431b1fb465d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
p-811c9fd4.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
12 KB
6 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-811c9fd4.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
c899b718605047f29624a74f1558d67f7b787035eea7742359e1e40315d2ae4d
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/vime.esm.js?ver=4.7.3
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-2f23"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a6431b6fef65d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
Group-6.svg
www.bizzabo.com/wp-content/uploads/2022/12/
3 KB
2 KB
Image
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2022/12/Group-6.svg
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
fd675417663ee68afb1e897fdaf9042e130f8afc1cb45d135d49651953478acc
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Fri, 02 Dec 2022 13:54:00 GMT
server
cloudflare
etag
W/"638a0378-c25"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
image/svg+xml
cache-control
max-age=31536000
cf-ray
82a6431b880465d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
BigPicture.svg
www.bizzabo.com/wp-content/uploads/2023/10/
8 KB
4 KB
Image
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2023/10/BigPicture.svg
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
49b3293887846540037639cd93c65d04d9710cd1a10913057352c5fa90617bf9
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Mon, 23 Oct 2023 12:07:18 GMT
server
cloudflare
etag
W/"653661f6-21d8"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
image/svg+xml
cache-control
max-age=31536000
cf-ray
82a6431b880765d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
kilk-menu-icon.png
www.bizzabo.com/wp-content/uploads/2023/07/
3 KB
3 KB
Image
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2023/07/kilk-menu-icon.png
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
3df9703cfe4aeb19ae11231636ef74bf761bd7cafb3b6d86e680ffe24551ae5a
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
content-length
2750
last-modified
Thu, 20 Jul 2023 14:05:21 GMT
server
cloudflare
etag
"64b93f21-abe"
x-frame-options
SAMEORIGIN
content-type
image/webp
cache-control
max-age=31536000
accept-ranges
bytes
cf-ray
82a6431b880865d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
Secure-3.svg
www.bizzabo.com/wp-content/uploads/2023/10/
4 KB
2 KB
Image
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2023/10/Secure-3.svg
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
4381fdee6eb57e24b8379a63391ab29359bbf9644982d2c96b25272c42aef01b
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Wed, 11 Oct 2023 14:28:19 GMT
server
cloudflare
etag
W/"6526b103-fc2"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
image/svg+xml
cache-control
max-age=31536000
cf-ray
82a6431b880a65d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
TrackEventSuccess-1.svg
www.bizzabo.com/wp-content/uploads/2023/10/
7 KB
4 KB
Image
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2023/10/TrackEventSuccess-1.svg
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
c8a36c446820096f126ea203af46e14611740385f97a9d622b25689bffdd2e36
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Mon, 23 Oct 2023 12:07:29 GMT
server
cloudflare
etag
W/"65366201-1d0b"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
image/svg+xml
cache-control
max-age=31536000
cf-ray
82a6431b880b65d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
Klik-1.png
www.bizzabo.com/wp-content/uploads/2022/01/
22 KB
22 KB
Image
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2022/01/Klik-1.png
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
35bf908bb001d22fcb228399334b60e4c8e0632170fffeb2e4337746ec2611d7
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
content-length
22500
last-modified
Wed, 11 Oct 2023 15:19:27 GMT
server
cloudflare
etag
"6526bcff-57e4"
x-frame-options
SAMEORIGIN
content-type
image/webp
cache-control
max-age=31536000
accept-ranges
bytes
cf-ray
82a6431b880e65d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
Mask-group-1.png
www.bizzabo.com/wp-content/uploads/2022/01/
25 KB
25 KB
Image
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2022/01/Mask-group-1.png
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
afeec60e36142a4b859804cc54265c747a9515dff89b98d31c6a36cce60f1b84
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
content-length
25740
last-modified
Wed, 03 May 2023 08:25:00 GMT
server
cloudflare
etag
"64521a5c-648c"
x-frame-options
SAMEORIGIN
content-type
image/webp
cache-control
max-age=31536000
accept-ranges
bytes
cf-ray
82a6431b881065d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
inboundimage-1.png
www.bizzabo.com/wp-content/uploads/2022/01/
16 KB
16 KB
Image
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2022/01/inboundimage-1.png
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
644147ba037e0d46c76888e3a42e7d1dc81c2c5b0cc603e51fe53a3afc166fc6
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
content-length
16394
last-modified
Tue, 16 May 2023 14:00:46 GMT
server
cloudflare
etag
"64638c8e-400a"
x-frame-options
SAMEORIGIN
content-type
image/webp
cache-control
max-age=31536000
accept-ranges
bytes
cf-ray
82a6431b881265d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
Q2-23-Industry-Survey_Megamenu-Illustration-2.png
www.bizzabo.com/wp-content/uploads/2022/01/
32 KB
32 KB
Image
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2022/01/Q2-23-Industry-Survey_Megamenu-Illustration-2.png
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
8d4f855f40db32ab9f7bb08887ab90b9cebf76656ade0eb2dfef11d62dc71e50
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
content-length
32908
last-modified
Tue, 01 Aug 2023 14:22:13 GMT
server
cloudflare
etag
"64c91515-808c"
x-frame-options
SAMEORIGIN
content-type
image/webp
cache-control
max-age=31536000
accept-ranges
bytes
cf-ray
82a6431b881465d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
Eventex2023-Badges-1.png
www.bizzabo.com/wp-content/uploads/2022/01/
33 KB
34 KB
Image
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2022/01/Eventex2023-Badges-1.png
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
ad0cefb3724779d2f3642da072187165771c0bea737b8a0f14610d3c6ca2bc3d
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
content-length
34280
last-modified
Tue, 01 Aug 2023 14:36:19 GMT
server
cloudflare
etag
"64c91863-85e8"
x-frame-options
SAMEORIGIN
content-type
image/webp
cache-control
max-age=31536000
accept-ranges
bytes
cf-ray
82a6431b881565d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
crowd.png
www.bizzabo.com/wp-content/uploads/2023/11/
4 KB
4 KB
Image
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2023/11/crowd.png
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
4cd26533c2875bf11d1b0e7e942bc1ae59e67bb205e6ea8506ceb3fdc08d1e25
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
content-length
4266
last-modified
Wed, 01 Nov 2023 15:24:55 GMT
server
cloudflare
etag
"65426dc7-10aa"
x-frame-options
SAMEORIGIN
content-type
image/webp
cache-control
max-age=31536000
accept-ranges
bytes
cf-ray
82a6431b881665d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
star-filled.svg
www.bizzabo.com/wp-content/uploads/2022/01/
836 B
824 B
Image
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2022/01/star-filled.svg
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
610ce3f6a43857c98c38666514b808e4879d67319b65c81d5e6dc5266f99fd9b
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 29 Jun 2023 12:42:32 GMT
server
cloudflare
etag
W/"649d7c38-344"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
image/svg+xml
cache-control
max-age=31536000
cf-ray
82a6431b881765d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
star-half.svg
www.bizzabo.com/wp-content/uploads/2022/01/
2 KB
979 B
Image
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2022/01/star-half.svg
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
a6c219653dd498c88c2d66572c7f46315352a967149f8c797bc8af7ed154429c
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 29 Jun 2023 12:42:31 GMT
server
cloudflare
etag
W/"649d7c37-6eb"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
image/svg+xml
cache-control
max-age=31536000
cf-ray
82a6431b881865d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
capterra.png
www.bizzabo.com/wp-content/uploads/2023/11/
5 KB
5 KB
Image
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2023/11/capterra.png
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
ee07d1b7cdfe732a00e9cf14d8941cdf7899a25820faffd84200126f31c0dba8
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
content-length
4686
last-modified
Wed, 01 Nov 2023 15:24:59 GMT
server
cloudflare
etag
"65426dcb-124e"
x-frame-options
SAMEORIGIN
content-type
image/webp
cache-control
max-age=31536000
accept-ranges
bytes
cf-ray
82a6431b881965d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
trustradius.png
www.bizzabo.com/wp-content/uploads/2023/11/
5 KB
6 KB
Image
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2023/11/trustradius.png
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
c9ee04d95db0d3c52a42b2ba144ab85aecc1376a55e346e7d69338511ab143d7
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
content-length
5430
last-modified
Wed, 01 Nov 2023 15:25:05 GMT
server
cloudflare
etag
"65426dd1-1536"
x-frame-options
SAMEORIGIN
content-type
image/webp
cache-control
max-age=31536000
accept-ranges
bytes
cf-ray
82a6431b881a65d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
star-empty.svg
www.bizzabo.com/wp-content/uploads/2022/01/
848 B
829 B
Image
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2022/01/star-empty.svg
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
aca7c67377829f4f546e68a3049560194b31dfa647880b2f8cc299633d4f5e18
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 29 Jun 2023 12:42:30 GMT
server
cloudflare
etag
W/"649d7c36-350"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
image/svg+xml
cache-control
max-age=31536000
cf-ray
82a6431b881c65d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
p-6b45e5c2.entry.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
11 KB
4 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-6b45e5c2.entry.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-811c9fd4.js
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
ea2233387291350345ef32628bf2f5fbb31d0094b1d174b77fed7a3a84b47382
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-811c9fd4.js
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-2c04"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a6431c689d65d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
p-5a105590.entry.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
42 KB
13 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-5a105590.entry.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-811c9fd4.js
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
0d89170029b91fdbd209500d67aaec62eeeaeabd370528b77a4102c61ac8d1ec
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-811c9fd4.js
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-a622"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a6431c689e65d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
p-41f2e10e.entry.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
43 KB
13 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-41f2e10e.entry.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-811c9fd4.js
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
cf8fbe9f4374e9a5377e5a202f813cf8ae682c386274d0dfdb8e8a83e669b0eb
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-811c9fd4.js
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-aa7e"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a6431c68a065d6-FRA
expires
Fri, 22 Nov 2024 03:17:57 GMT
main.js
www.bizzabo.com/cdn-cgi/challenge-platform/h/g/scripts/jsd/9914b343/ Frame 3451
Redirect Chain
  • https://www.bizzabo.com/cdn-cgi/challenge-platform/scripts/jsd/main.js
  • https://www.bizzabo.com/cdn-cgi/challenge-platform/h/g/scripts/jsd/9914b343/main.js
7 KB
4 KB
Script
General
Full URL
https://www.bizzabo.com/cdn-cgi/challenge-platform/h/g/scripts/jsd/9914b343/main.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
20f7ca006959ee2cd1c1f2b74d42a0f8d4031ace41e14fda1d11968dfedff49b
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

accept-language
de-DE,de;q=0.9
Referer
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
strict-transport-security
max-age=31536000; includeSubDomains; preload
server
cloudflare
vary
accept-encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript; charset=UTF-8
cache-control
max-age=14400, public
cf-ray
82a6431d491165d6-FRA
alt-svc
h3=":443"; ma=86400

Redirect headers

date
Thu, 23 Nov 2023 03:17:57 GMT
content-encoding
gzip
x-content-type-options
nosniff
strict-transport-security
max-age=31536000; includeSubDomains; preload
server
cloudflare
vary
accept-encoding
x-frame-options
SAMEORIGIN
access-control-allow-origin
*
location
/cdn-cgi/challenge-platform/h/g/scripts/jsd/9914b343/main.js
cache-control
max-age=300, public
cf-ray
82a6431c88ac65d6-FRA
alt-svc
h3=":443"; ma=86400
p-f021dfd0.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
848 B
805 B
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-f021dfd0.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
66b1aa6d1315502bdef332a1e4ebe466c274c81399aab7c1bdd6bcb8ea517ccc
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-6b45e5c2.entry.js
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-350"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a6431d792e65d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
p-bd0aac21.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
245 B
519 B
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-bd0aac21.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
3b6947cc6a494ddd10accd6dade7093a127c4a39bb6bfb43c2ca2b91602ba177
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-6b45e5c2.entry.js
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-f5"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a6431d793165d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
p-f3727652.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
1 KB
1 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-f3727652.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
9d68898155919849a6977913dc8f68fb8fba5296aeb5f260ce6249f940558f9a
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-6b45e5c2.entry.js
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-511"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a6431d793265d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
p-8904db17.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
142 B
413 B
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-8904db17.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
7bb4243d34bb5ca41fa929028b3f349e91f64389b6e8333fa6a278322038826a
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-6b45e5c2.entry.js
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-8e"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a6431d793365d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
p-8ffe7be8.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
2 KB
1 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-8ffe7be8.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
3e984e1963a69a0d38b89eaee396e1c31d466e965e4b6fa7df0e2cf0ea75b1d8
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-6b45e5c2.entry.js
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-636"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a6431d793465d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
p-5d182d13.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
819 B
761 B
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-5d182d13.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
e0cc41d813e6d79bc7bb5bc7687b4dba3efecdc92a6d92c2eb3c3f1b5d25fe79
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-6b45e5c2.entry.js
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-333"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a6431d793565d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
p-b0ea4d0d.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
244 B
490 B
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-b0ea4d0d.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
4e577c5503613542bd21f807b0435db0cd53cd536822726d434f8a61f76f83ea
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-6b45e5c2.entry.js
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-f4"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a6431d793765d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
p-874fa941.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
139 B
421 B
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-874fa941.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
9ecdd13680c1d0d375eedb025d679918f7d563636729ae7ad5d7b78abcdadd35
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-6b45e5c2.entry.js
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-8b"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a6431d793865d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
p-e056694f.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
1 KB
913 B
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-e056694f.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
5e049cea1e3b411c9f0bcbbf2482a9fe781d50315a5860e751b15f8147787287
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-6b45e5c2.entry.js
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-598"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a6431d793965d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
p-3bfefa6f.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
2 KB
1 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-3bfefa6f.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
266d832b6c89d38135abdce570685208ae20074e5ede974e47a8b3e6b119d0dc
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-41f2e10e.entry.js
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-9c5"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a6431d793a65d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
p-dbd3a850.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
2 KB
1 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-dbd3a850.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
b83296e3f6b7ca06e13fbe350ee3d90dc7eccee20fd440b745b0ca77889b2bc7
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-41f2e10e.entry.js
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-8e0"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a6431d793b65d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
p-7afe5dc8.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
189 B
463 B
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-7afe5dc8.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
8accd5147fa9a68f97f06654fe707e1d293273bd082a44b233decfbed476a86c
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-41f2e10e.entry.js
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-bd"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a6431d793c65d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
p-5ff08183.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
181 B
461 B
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-5ff08183.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
bdb7916ccff87d9bd5e077a0310eca791f04da8551f9174d7c364ef2000b9a13
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-5a105590.entry.js
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-b5"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a6431d894b65d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
82a643139c1c9963
www.bizzabo.com/cdn-cgi/challenge-platform/h/g/jsd/r/ Frame 3451
0
337 B
XHR
General
Full URL
https://www.bizzabo.com/cdn-cgi/challenge-platform/h/g/jsd/r/82a643139c1c9963
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/cdn-cgi/challenge-platform/scripts/jsd/main.js
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36
Content-Type
application/json

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-content-type-options
nosniff
content-encoding
gzip
server
cloudflare
x-frame-options
SAMEORIGIN
content-type
text/plain; charset=UTF-8
cf-ray
82a6431e19a865d6-FRA
alt-svc
h3=":443"; ma=86400
sprite.svg
cdn.jsdelivr.net/npm/@vime/core@latest/icons/
4 KB
2 KB
Fetch
General
Full URL
https://cdn.jsdelivr.net/npm/@vime/core@latest/icons/sprite.svg
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-dbd3a850.js
Protocol
H2
Security
TLS 1.3, , AES_128_GCM
Server
2606:4700::6810:5714 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
8b1fe77aaae0cfef59f8dcb9a24dfac3fd586386f1e14e22e2cf86bb07e0b65d
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff

Request headers

accept-language
de-DE,de;q=0.9
Referer
https://www.bizzabo.com/
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-content-type-options
nosniff
cf-cache-status
HIT
nel
{"success_fraction":0.01,"report_to":"cf-nel","max_age":604800}
age
27325
x-jsd-version
4.7.3
content-encoding
br
x-cache
HIT
cross-origin-resource-policy
cross-origin
alt-svc
h3=":443"; ma=86400
x-served-by
cache-fra-eddf8230077-FRA
x-jsd-version-type
version
server
cloudflare
etag
W/"1146-ATHFGWnqmUBK4CO1r1e6Oj3Z6ZE"
vary
Accept-Encoding
report-to
{"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report\/v3?s=9kv14mNovimmEulzQ%2FKy%2FBRIK8vHqbFG9FbDJcOuoBR6fKhycH%2FVFBmxDDuYiXEkR%2F%2BkJkGHpLUungZLH7D7BFBWoLTTKqN%2F8ctvVaY5Slb426Sm0Q1RniVA%2FLHYP%2FkkI7r6l4omryjkBqGeWI8%3D"}],"group":"cf-nel","max_age":604800}
content-type
image/svg+xml
access-control-allow-origin
*
access-control-expose-headers
*
cache-control
public, max-age=604800, s-maxage=43200
timing-allow-origin
*
cf-ray
82a6431f7c1c18c7-FRA
eeos.mp4
www.bizzabo.com/wp-content/uploads/2023/01/
32 KB
0
Media
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2023/01/eeos.mp4
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/
Accept-Encoding
identity;q=1, *;q=0
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36
Range
bytes=0-

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
x-proxy-cache-info
DT:1
Content-Range
bytes 0-79187943/79187944
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
Content-Length
79187944
last-modified
Thu, 06 Apr 2023 08:03:10 GMT
server
cloudflare
etag
"642e7cbe-4b84fe8"
x-frame-options
SAMEORIGIN
content-type
video/mp4
cache-control
max-age=31536000
cf-ray
82a6431f1a4665d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
p-e535f0ab.entry.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
5 KB
2 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-e535f0ab.entry.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-811c9fd4.js
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
2ebb6ecbb986ce04ae5a5dd890d7086b32a2e11211cc7bc5c2ad8997474f7b06
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-811c9fd4.js
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-12f4"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a6431f1a4765d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
p-dd53bacf.entry.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
2 KB
1 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-dd53bacf.entry.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-811c9fd4.js
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
e7ee4d98bff6acef4914705111e9ca2c136d876f50a3a458523d7ba82fe331ff
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-811c9fd4.js
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-79a"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643207b0965d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
p-874ee857.entry.js
www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/
5 KB
2 KB
Script
General
Full URL
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-874ee857.entry.js
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-811c9fd4.js
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
cf341df9232a664a869620b2296a2f04150d417b8f110f1132dd9fa7dab7be22
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/wp-content/plugins/oxyextras/components/assets/vime/@vime/core/dist/vime/p-811c9fd4.js
Origin
https://www.bizzabo.com
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
content-encoding
gzip
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-proxy-cache-info
DT:1
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
last-modified
Thu, 06 Apr 2023 08:03:07 GMT
server
cloudflare
etag
W/"642e7cbb-15fb"
vary
Accept-Encoding
x-frame-options
SAMEORIGIN
content-type
application/javascript
cache-control
max-age=31536000
cf-ray
82a643208b1365d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
eeos.mp4
www.bizzabo.com/wp-content/uploads/2023/01/
717 KB
0
Media
General
Full URL
https://www.bizzabo.com/wp-content/uploads/2023/01/eeos.mp4
Requested by
Host: www.bizzabo.com
URL: https://www.bizzabo.com/
Protocol
H3
Security
QUIC, , AES_128_GCM
Server
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
Software
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Referer
https://www.bizzabo.com/
Accept-Encoding
identity;q=1, *;q=0
accept-language
de-DE,de;q=0.9
User-Agent
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.159 Safari/537.36
Range
bytes=196608-

Response headers

date
Thu, 23 Nov 2023 03:17:58 GMT
strict-transport-security
max-age=31536000; includeSubDomains; preload
x-content-type-options
nosniff
cf-cache-status
DYNAMIC
x-proxy-cache-info
DT:1
Content-Range
bytes 196608-79187943/79187944
host-header
8441280b0c35cbc1147f8ba998a563a7
alt-svc
h3=":443"; ma=86400
Content-Length
78991336
last-modified
Thu, 06 Apr 2023 08:03:10 GMT
server
cloudflare
etag
"642e7cbe-4b84fe8"
x-frame-options
SAMEORIGIN
content-type
video/mp4
cache-control
max-age=31536000
cf-ray
82a64320cb3465d6-FRA
expires
Fri, 22 Nov 2024 03:17:58 GMT
rum
www.bizzabo.com/cdn-cgi/
0
142 B
XHR