Submitted URL:
Effective URL:
Submission: On December 01 via manual from DK — Scanned from DK


This website contacted 4 IPs in 1 countries across 3 domains to perform 87 HTTP transactions. The main IP is 2606:4700::6812:1734, located in United States and belongs to CLOUDFLARENET, US. The main domain is The Cisco Umbrella rank of the primary domain is 988718.
TLS certificate: Issued by GTS CA 1P5 on October 16th 2023. Valid for: 3 months.
This is the only time was scanned on! Verdict: No classification

Domain & IP information

IP Address AS Autonomous System
1 1 14618 (AMAZON-AES)
2 87 2606:4700::68... 13335 (CLOUDFLAR...)
1 2606:4700::68... 13335 (CLOUDFLAR...)
1 2606:4700::68... 13335 (CLOUDFLAR...)
87 4
Apex Domain
88 — Cisco Umbrella Rank: 344360 — Cisco Umbrella Rank: 988718 — Cisco Umbrella Rank: 70979
1 MB
1 — Cisco Umbrella Rank: 313
2 KB
1 — Cisco Umbrella Rank: 864
7 KB
87 3
Domain Requested by
86 1 redirects
1 1 redirects
1 1 redirects
87 5
Subject Issuer Validity Valid
2023-10-16 -
3 months
Cloudflare Inc ECC CA-3
2023-04-10 -
a year

This page contains 2 frames:

Primary Page:
Frame ID: 81230C83573082ED4094D5AB993387F4
Requests: 89 HTTP requests in this frame

Frame ID: BAB5DF7AB009CBFCF1F93394523C2904
Requests: 2 HTTP requests in this frame


Page Title

#1 Event Management Software for B2B Conferences | Bizzaboclosearrow-circle-o-downchevron-downtwitterfacebooklinkedinangle-downellipsis-vinstagrammagnifiercrossarrow-defualtplaypause

Page URL History Show full URLs

  1. HTTP 301 Page URL

Detected technologies

Overall confidence: 100%
Detected patterns
  • /wp-(?:content|includes)/

Overall confidence: 100%
Detected patterns
  • wp-content/plugins/oxygen

Overall confidence: 100%
Detected patterns
  • static\.cloudflareinsights\.com/beacon(?:\.min)?\.js

Overall confidence: 100%
Detected patterns
  • /flickity(?:\.pkgd)?(?:\.min)?\.js

Overall confidence: 100%
Detected patterns
  • jquery.*\.js(?:\?ver(?:sion)?=([\d.]+))?

Overall confidence: 100%
Detected patterns
  • //cdn\.jsdelivr\.net/

Page Statistics


98 %

75 %





1311 kB

3916 kB


Page URL History

This captures the URL locations of the websites, including HTTP redirects and client-side redirects via JavaScript or Meta fields.

  1. HTTP 301 Page URL

Redirected requests

There were HTTP redirect chains for the following requests:

Request Chain 66
  • HTTP 302
Request Chain 88
  • HTTP 301

87 HTTP transactions

Primary Request /
Redirect Chain
299 KB
49 KB
Full URL
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

h3=":443"; ma=86400
text/html; charset=UTF-8
Fri, 01 Dec 2023 11:15:08 GMT
Fri, 01 Dec 2023 11:15:08 GMT
Fri, 01 Dec 2023 07:26:39 GMT
max-age=31536000; includeSubDomains; preload
Accept-Encoding Accept-Encoding
0 NC:000000 UP:

Redirect headers

text/html; charset=utf-8
Fri, 01 Dec 2023 11:15:07 GMT
Fri, 01 Dec 2023 11:15:06 GMT
max-age=31536000; includeSubDomains
Accept, Accept-Encoding
13 KB
1003 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Fri, 01 Dec 2023 07:26:38 GMT
Sat, 30 Nov 2024 11:15:08 GMT
107 KB
18 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 09 Nov 2023 11:38:14 GMT
Sat, 30 Nov 2024 11:15:08 GMT
30 KB
7 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Fri, 01 Dec 2023 07:26:38 GMT
Sat, 30 Nov 2024 11:15:08 GMT
30 KB
7 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Fri, 01 Dec 2023 07:26:38 GMT
Sat, 30 Nov 2024 11:15:08 GMT
17 KB
5 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Fri, 01 Dec 2023 07:26:38 GMT
Sat, 30 Nov 2024 11:15:08 GMT
32 KB
7 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Fri, 01 Dec 2023 07:26:38 GMT
Sat, 30 Nov 2024 11:15:08 GMT
86 KB
35 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 09 Nov 2023 11:38:14 GMT
Sat, 30 Nov 2024 11:15:08 GMT
117 KB
41 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 30 Nov 2023 13:07:22 GMT
Sat, 30 Nov 2024 11:15:08 GMT
1 KB
607 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Fri, 01 Dec 2023 07:26:38 GMT
Sat, 30 Nov 2024 11:15:08 GMT
18 KB
3 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Fri, 01 Dec 2023 07:26:38 GMT
Sat, 30 Nov 2024 11:15:08 GMT
54 KB
9 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Fri, 01 Dec 2023 07:26:38 GMT
Sat, 30 Nov 2024 11:15:08 GMT
516 B
307 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Fri, 01 Dec 2023 07:26:38 GMT
Sat, 30 Nov 2024 11:15:08 GMT
63 KB
10 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Fri, 01 Dec 2023 07:26:39 GMT
Sat, 30 Nov 2024 11:15:08 GMT
291 KB
58 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Fri, 01 Dec 2023 07:26:38 GMT
Sat, 30 Nov 2024 11:15:08 GMT
64 B
Full URL
-, , ASN (),
Reverse DNS
Resource Hash

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

66 B
Full URL
-, , ASN (),
Reverse DNS
Resource Hash

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

66 B
Full URL
-, , ASN (),
Reverse DNS
Resource Hash

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

25 KB
3 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Fri, 01 Dec 2023 07:26:38 GMT
Sat, 30 Nov 2024 11:15:08 GMT
13 KB
5 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 30 Nov 2023 13:07:22 GMT
Sat, 30 Nov 2024 11:15:08 GMT
9 KB
3 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 30 Nov 2023 13:07:22 GMT
Sat, 30 Nov 2024 11:15:08 GMT
20 KB
6 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 30 Nov 2023 13:07:22 GMT
Sat, 30 Nov 2024 11:15:08 GMT
10 KB
3 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 30 Nov 2023 13:07:22 GMT
Sat, 30 Nov 2024 11:15:08 GMT
14 KB
5 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 09 Nov 2023 11:58:02 GMT
Sat, 30 Nov 2024 11:15:08 GMT
51 KB
12 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:08 GMT
14 KB
3 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:08 GMT
27 KB
8 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:08 GMT
12 KB
3 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:08 GMT
13 KB
4 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:08 GMT
53 KB
17 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:08 GMT
29 KB
10 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:08 GMT
11 KB
3 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:08 GMT
1 KB
464 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:08 GMT
19 KB
5 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:08 GMT
9 KB
3 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 30 Nov 2023 13:06:14 GMT
Sat, 30 Nov 2024 11:15:08 GMT
20 KB
7 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6810:3965 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:08 GMT
Tue, 10 Oct 2023 21:38:13 GMT
public, max-age=86400
546 B
Full URL
-, , ASN (),
Reverse DNS
Resource Hash

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

604 B
1 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
script-src 'none'; report-uri; report-to cf-csp-endpoint
h3=":443"; ma=86400
Thu, 20 Jul 2023 14:09:43 GMT
Sat, 30 Nov 2024 11:15:09 GMT
485 B
398 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:10 GMT
Sat, 30 Nov 2024 11:15:09 GMT
29 KB
29 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:10 GMT
max-age=31536000; includeSubDomains; preload
0 NC:000000 UP:
h3=":443"; ma=86400
Accept-Encoding, Accept-Encoding
text/html; charset=UTF-8
no-cache, must-revalidate, max-age=0
<>; rel=""
Wed, 11 Jan 1984 05:00:00 GMT
193 KB
94 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:09 GMT
Sat, 30 Nov 2024 11:15:09 GMT
208 KB
98 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:09 GMT
Sat, 30 Nov 2024 11:15:09 GMT
222 KB
110 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:09 GMT
Sat, 30 Nov 2024 11:15:09 GMT
223 KB
111 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:09 GMT
Sat, 30 Nov 2024 11:15:09 GMT
202 KB
96 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:09 GMT
Sat, 30 Nov 2024 11:15:09 GMT
65 KB
66 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
script-src 'none'; report-uri; report-to cf-csp-endpoint
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:09 GMT
Sat, 30 Nov 2024 11:15:09 GMT
190 KB
93 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:09 GMT
Sat, 30 Nov 2024 11:15:09 GMT
12 KB
6 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:09 GMT
3 KB
1 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Fri, 02 Dec 2022 13:54:00 GMT
Sat, 30 Nov 2024 11:15:09 GMT
8 KB
4 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Mon, 23 Oct 2023 12:07:18 GMT
Sat, 30 Nov 2024 11:15:09 GMT
3 KB
3 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 20 Jul 2023 14:05:21 GMT
Sat, 30 Nov 2024 11:15:09 GMT
4 KB
2 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 11 Oct 2023 14:28:19 GMT
Sat, 30 Nov 2024 11:15:09 GMT
7 KB
4 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Mon, 23 Oct 2023 12:07:29 GMT
Sat, 30 Nov 2024 11:15:09 GMT
22 KB
22 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 11 Oct 2023 15:19:27 GMT
Sat, 30 Nov 2024 11:15:09 GMT
25 KB
26 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
script-src 'none'; report-uri; report-to cf-csp-endpoint
h3=":443"; ma=86400
Wed, 03 May 2023 08:25:00 GMT
Sat, 30 Nov 2024 11:15:09 GMT
16 KB
16 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Tue, 16 May 2023 14:00:46 GMT
Sat, 30 Nov 2024 11:15:09 GMT
32 KB
32 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Tue, 01 Aug 2023 14:22:13 GMT
Sat, 30 Nov 2024 11:15:09 GMT
33 KB
34 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Tue, 01 Aug 2023 14:36:19 GMT
Sat, 30 Nov 2024 11:15:09 GMT
4 KB
4 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 01 Nov 2023 15:24:55 GMT
Sat, 30 Nov 2024 11:15:09 GMT
836 B
661 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 29 Jun 2023 12:42:32 GMT
Sat, 30 Nov 2024 11:15:09 GMT
2 KB
785 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 29 Jun 2023 12:42:31 GMT
Sat, 30 Nov 2024 11:15:09 GMT
5 KB
5 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
script-src 'none'; report-uri; report-to cf-csp-endpoint
h3=":443"; ma=86400
Wed, 01 Nov 2023 15:24:59 GMT
Sat, 30 Nov 2024 11:15:09 GMT
5 KB
5 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Wed, 01 Nov 2023 15:25:05 GMT
Sat, 30 Nov 2024 11:15:09 GMT
848 B
608 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 29 Jun 2023 12:42:30 GMT
Sat, 30 Nov 2024 11:15:09 GMT
11 KB
4 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:09 GMT
42 KB
12 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:09 GMT
43 KB
13 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:09 GMT
main.js Frame BAB5
Redirect Chain
7 KB
4 KB
Full URL
Requested by
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
application/javascript; charset=UTF-8
max-age=14400, public
h3=":443"; ma=86400

Redirect headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
max-age=300, public
h3=":443"; ma=86400
82eae91568f9568e Frame BAB5
367 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
text/plain; charset=UTF-8
h3=":443"; ma=86400
848 B
639 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:09 GMT
245 B
288 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:09 GMT
1 KB
835 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:09 GMT
142 B
182 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:09 GMT
2 KB
829 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:09 GMT
819 B
531 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:09 GMT
244 B
282 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:09 GMT
139 B
190 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:09 GMT
1 KB
682 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:09 GMT
2 KB
1 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:09 GMT
189 B
255 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:09 GMT
181 B
230 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:09 GMT
2 KB
1 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:09 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:09 GMT
4 KB
2 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6810:5514 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
cache-fra-eddf8230035-FRA, cache-bma1659-BMA
public, max-age=604800, s-maxage=43200
32 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

identity;q=1, *;q=0
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:10 GMT
max-age=31536000; includeSubDomains; preload
bytes 0-79187943/79187944
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:10 GMT
Sat, 30 Nov 2024 11:15:09 GMT
5 KB
2 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:09 GMT
2 KB
924 B
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:10 GMT
5 KB
2 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:10 GMT
max-age=31536000; includeSubDomains; preload
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:07 GMT
Sat, 30 Nov 2024 11:15:10 GMT
360 KB
Full URL
Requested by
TLS 1.3, , AES_128_GCM
2606:4700::6812:1734 , United States, ASN13335 (CLOUDFLARENET, US),
Reverse DNS
cloudflare /
Resource Hash
Security Headers
Name Value
Strict-Transport-Security max-age=31536000; includeSubDomains; preload
X-Content-Type-Options nosniff
X-Frame-Options SAMEORIGIN

Request headers

identity;q=1, *;q=0
Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/119.0.6045.199 Safari/537.36

Response headers

Fri, 01 Dec 2023 11:15:10 GMT
max-age=31536000; includeSubDomains; preload
script-src 'none'; report-uri; report-to cf-csp-endpoint
bytes 196608-79187943/79187944
h3=":443"; ma=86400
Thu, 06 Apr 2023 08:03:10 GMT
Sat, 30 Nov 2024 11:15:10 GMT