172.2.212.35.bc.googleusercontent.com
GOOGLE, US


Seen 32 times between July 11th, 2024 and July 11th, 2024.


General Info Open in Search

Geo Washington, District of Columbia, United States (US) —
Created November 17th, 2008
Domain googleusercontent.com (The registered domain)
AS AS15169 - GOOGLE, US
Note: An IP might be announced by multiple ASs. This is not shown.
Registrar ARIN
Route 35.212.0.0/17 (Route of ASN)
PTR 172.2.212.35.bc.googleusercontent.com(PTR record of primary IP)
IPv4 35.212.2.172  35.212.2.172 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

No direct hits
Nothing is hosted on this domain

Incoming hits
Summary of pages that talked to this domain

Recent scans (32 total) Show all

URL Age
glenm.savingshighwayglobal.com 6 days
billreductionpro.com 10 days
savingshighwayglobal.com 11 days
freedomconcepts.savingshighwayglobal.com 13 days
danielfrederick.savingshighwayglobal.com/?page=shgawesome1 a month

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Related screenshots
Screenshots of pages that talked to this domain

DNS recordsRetrieved via DNS ANY query

A 35.212.2.172 (TTL: 3600)
A 35.212.2.172 (TTL: 3600)

Registration information

Created November 17th, 2008
Updated October 16th, 2023
Registrar MarkMonitor, Inc.

WHOIS for 172.2.212.35.bc.googleusercontent.com

Domain Name: googleusercontent.com
Registry Domain ID: 1528918319_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.markmonitor.com
Registrar URL: http://www.markmonitor.com
Updated Date: 2023-10-16T09:55:54+0000
Creation Date: 2008-11-17T15:58:29+0000
Registrar Registration Expiration Date: 2024-11-17T00:00:00+0000
Registrar: MarkMonitor, Inc.
Registrar IANA ID: 292
Registrar Abuse Contact Email: abusecomplaints@markmonitor.com
Registrar Abuse Contact Phone: +1.2086851750
Domain Status: clientUpdateProhibited (https://www.icann.org/epp#clientUpdateProhibited)
Domain Status: clientTransferProhibited (https://www.icann.org/epp#clientTransferProhibited)
Domain Status: clientDeleteProhibited (https://www.icann.org/epp#clientDeleteProhibited)
Domain Status: serverUpdateProhibited (https://www.icann.org/epp#serverUpdateProhibited)
Domain Status: serverTransferProhibited (https://www.icann.org/epp#serverTransferProhibited)
Domain Status: serverDeleteProhibited (https://www.icann.org/epp#serverDeleteProhibited)
Registrant Organization: Google LLC
Registrant State/Province: CA
Registrant Country: US
Registrant Email: Select Request Email Form at https://domains.markmonitor.com/whois/googleusercontent.com
Admin Organization: Google LLC
Admin State/Province: CA
Admin Country: US
Admin Email: Select Request Email Form at https://domains.markmonitor.com/whois/googleusercontent.com
Tech Organization: Google LLC
Tech State/Province: CA
Tech Country: US
Tech Email: Select Request Email Form at https://domains.markmonitor.com/whois/googleusercontent.com
Name Server: ns3.google.com
Name Server: ns4.google.com
Name Server: ns2.google.com
Name Server: ns1.google.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2024-07-11T19:54:08+0000 <<<

For more information on WHOIS status codes, please visit:
  https://www.icann.org/resources/pages/epp-status-codes

If you wish to contact this domain’s Registrant, Administrative, or Technical
contact, and such email address is not visible above, you may do so via our web
form, pursuant to ICANN’s Temporary Specification. To verify that you are not a
robot, please enter your email address to receive a link to a page that
facilitates email communication with the relevant contact(s).

Web-based WHOIS:
  https://domains.markmonitor.com/whois

If you have a legitimate interest in viewing the non-public WHOIS details, send
your request and the reasons for your request to whoisrequest@markmonitor.com
and specify the domain name in the subject line. We will review that request and
may ask for supporting documentation and explanation.

The data in MarkMonitor’s WHOIS database is provided for information purposes,
and to assist persons in obtaining information about or related to a domain
name’s registration record. While MarkMonitor believes the data to be accurate,
the data is provided "as is" with no guarantee or warranties regarding its
accuracy.

By submitting a WHOIS query, you agree that you will use this data only for
lawful purposes and that, under no circumstances will you use this data to:
  (1) allow, enable, or otherwise support the transmission by email, telephone,
or facsimile of mass, unsolicited, commercial advertising, or spam; or
  (2) enable high volume, automated, or electronic processes that send queries,
data, or email to MarkMonitor (or its systems) or the domain name contacts (or
its systems).

MarkMonitor reserves the right to modify these terms at any time.

By submitting this query, you agree to abide by this policy.

MarkMonitor Domain Management(TM)
Protecting companies and consumers in a digital world.

Visit MarkMonitor at https://www.markmonitor.com
Contact us at +1.8007459229
In Europe, at +44.02032062220
--