172.2.212.35.bc.googleusercontent.com
GOOGLE, US
Seen 32 times between July 11th, 2024 and July 11th, 2024.
General Info Open in Search
Geo | Washington, District of Columbia, United States (US) — |
Created | November 17th, 2008 |
Domain | googleusercontent.com (The registered domain) |
AS | AS15169 - GOOGLE, US
Note: An IP might be announced by multiple ASs. This is not shown. |
Registrar | ARIN |
Route | 35.212.0.0/17 (Route of ASN) |
PTR | 172.2.212.35.bc.googleusercontent.com(PTR record of primary IP) |
IPv4 | 35.212.2.172 35.212.2.172 |
No direct hits
Nothing is hosted on this domain
Incoming hits
Summary of pages that talked to this domain
Recent scans (32 total) Show all
URL | Age | |||||
---|---|---|---|---|---|---|
glenm.savingshighwayglobal.com | 6 days | 74 | 22 | 6 | ||
billreductionpro.com | 10 days | 50 | 14 | 5 | ||
savingshighwayglobal.com | 11 days | 84 | 22 | 5 | ||
freedomconcepts.savingshighwayglobal.com | 13 days | 74 | 21 | 5 | ||
danielfrederick.savingshighwayglobal.com/?page=shgawesome1 | a month | 43 | 19 | 4 |
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
DNS recordsRetrieved via DNS ANY query
A |
35.212.2.172
(TTL: 3600)
|
A |
35.212.2.172
(TTL: 3600)
|
Registration information
Created | November 17th, 2008 |
Updated | October 16th, 2023 |
Registrar | MarkMonitor, Inc. |
WHOIS for 172.2.212.35.bc.googleusercontent.com
Domain Name: googleusercontent.com Registry Domain ID: 1528918319_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.markmonitor.com Registrar URL: http://www.markmonitor.com Updated Date: 2023-10-16T09:55:54+0000 Creation Date: 2008-11-17T15:58:29+0000 Registrar Registration Expiration Date: 2024-11-17T00:00:00+0000 Registrar: MarkMonitor, Inc. Registrar IANA ID: 292 Registrar Abuse Contact Email: abusecomplaints@markmonitor.com Registrar Abuse Contact Phone: +1.2086851750 Domain Status: clientUpdateProhibited (https://www.icann.org/epp#clientUpdateProhibited) Domain Status: clientTransferProhibited (https://www.icann.org/epp#clientTransferProhibited) Domain Status: clientDeleteProhibited (https://www.icann.org/epp#clientDeleteProhibited) Domain Status: serverUpdateProhibited (https://www.icann.org/epp#serverUpdateProhibited) Domain Status: serverTransferProhibited (https://www.icann.org/epp#serverTransferProhibited) Domain Status: serverDeleteProhibited (https://www.icann.org/epp#serverDeleteProhibited) Registrant Organization: Google LLC Registrant State/Province: CA Registrant Country: US Registrant Email: Select Request Email Form at https://domains.markmonitor.com/whois/googleusercontent.com Admin Organization: Google LLC Admin State/Province: CA Admin Country: US Admin Email: Select Request Email Form at https://domains.markmonitor.com/whois/googleusercontent.com Tech Organization: Google LLC Tech State/Province: CA Tech Country: US Tech Email: Select Request Email Form at https://domains.markmonitor.com/whois/googleusercontent.com Name Server: ns3.google.com Name Server: ns4.google.com Name Server: ns2.google.com Name Server: ns1.google.com DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2024-07-11T19:54:08+0000 <<< For more information on WHOIS status codes, please visit: https://www.icann.org/resources/pages/epp-status-codes If you wish to contact this domain’s Registrant, Administrative, or Technical contact, and such email address is not visible above, you may do so via our web form, pursuant to ICANN’s Temporary Specification. To verify that you are not a robot, please enter your email address to receive a link to a page that facilitates email communication with the relevant contact(s). Web-based WHOIS: https://domains.markmonitor.com/whois If you have a legitimate interest in viewing the non-public WHOIS details, send your request and the reasons for your request to whoisrequest@markmonitor.com and specify the domain name in the subject line. We will review that request and may ask for supporting documentation and explanation. The data in MarkMonitor’s WHOIS database is provided for information purposes, and to assist persons in obtaining information about or related to a domain name’s registration record. While MarkMonitor believes the data to be accurate, the data is provided "as is" with no guarantee or warranties regarding its accuracy. By submitting a WHOIS query, you agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (1) allow, enable, or otherwise support the transmission by email, telephone, or facsimile of mass, unsolicited, commercial advertising, or spam; or (2) enable high volume, automated, or electronic processes that send queries, data, or email to MarkMonitor (or its systems) or the domain name contacts (or its systems). MarkMonitor reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy. MarkMonitor Domain Management(TM) Protecting companies and consumers in a digital world. Visit MarkMonitor at https://www.markmonitor.com Contact us at +1.8007459229 In Europe, at +44.02032062220 --