washingtonpost.com
AKAMAI-AS, US


Seen 18163+ times between November 28th, 2016 and September 20th, 2024.


General Info Open in Search

Geo Frankfurt am Main, Germany (DE) —
Created November 13th, 1995
AS AS16625 - AKAMAI-AS, US
Note: An IP might be announced by multiple ASs. This is not shown.
Registrar ARIN
Route 23.210.112.0/20 (Route of ASN)
PTR a23-210-114-74.deploy.static.akamaitechnologies.com(PTR record of primary IP)
IPv4 23.210.114.74 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

Incoming hits
Summary of pages that talked to this domain

ASNs AS14618 | 3367x AS13335 | 1702x AS16509 | 598x AS209242 | 533x AS15169 | 452x AS54113 | 193x AS396488 | 116x AS16276 | 81x AS53831 | 73x AS22612 | 63x

IPs 141.193.213.21 | 275x 172.64.146.151 | 267x 104.18.41.105 | 263x 141.193.213.20 | 253x 52.71.33.25 | 128x 3.227.42.160 | 120x 18.235.16.70 | 116x 66.119.118.64 | 116x 34.202.153.128 | 115x 3.224.183.176 | 114x

Domains p.liadm.com | 3247x www.liveintent.com | 648x www.dianomi.com | 551x play.google.com | 301x c.licasd.com | 228x newsbeezer.com | 186x mb.taboola.com | 121x www.physiciansmutual.com | 116x todaysnews.live | 89x www.spikejohnson.co.uk | 67x

Countries US | 6792x DE | 506x NL | 128x FR | 88x IN | 70x DK | 56x PL | 41x GB | 35x SG | 30x CA | 29x

Recent scans (8163 total) Show all

URL Age
p.liadm.com/imp?s=887276&amp%3Bli=most&amp%3Bm=08adb59d43e458ee8fd62ec49b8708... 6 hours
p.liadm.com/imp?s=1069959&li=most&m=08adb59d43e458ee8fd62ec49b8708b1&p=66eda0... 6 hours
www.physiciansmutual.com/web/dental?refnum=340278&oneClick=Dental&utm_source=... 6 hours
www.physiciansmutual.com/web/dental?refnum=340278&oneClick=Dental&utm_source=... 6 hours
p.liadm.com/imp?s=1069963&amp%3Bli=most&amp%3Bm=08adb59d43e458ee8fd62ec49b870... 6 hours

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recent screenshots
Screenshots of pages hosted on this domain

Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to

IPs 23.37.45.67 | 5089x 23.45.108.250 | 3428x 104.102.34.16 | 1350x 104.64.160.155 | 821x 23.79.130.154 | 679x 23.60.207.88 | 583x 184.30.219.4 | 560x 23.204.2.78 | 467x 23.199.210.20 | 457x 2.16.215.147 | 404x

Domains www.washingtonpost.com | 19460x helpcenter.washingtonpost.com | 369x subscribe.washingtonpost.com | 300x s2.washingtonpost.com | 211x palomaimages.washingtonpost.com | 172x css.washingtonpost.com | 74x voices.washingtonpost.com | 44x subscription.washingtonpost.com | 37x sli.washingtonpost.com | 18x games.washingtonpost.com | 14x

Recently observed hostnames on 'washingtonpost.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

classifiedsmarketplace.washingtonpost.com | 2024-05-15 crosswalker.elex.preview.now.washingtonpost.com | 2024-04-29 twpselectivity.washingtonpost.com | 2024-01-10 wpds-docs-git-icon-search.preview.now.washingtonpost.com | 2023-12-04 spectrum-git-spect-2790.preview.now.washingtonpost.com | 2023-12-04 recipe-admin-git-food-103.preview.now.washingtonpost.com | 2023-12-04 homepage-git-hcourt-url-fallback.preview.now.washingtonpost.com | 2023-12-04 subs-integration-git-bug-greg-noa.preview.now.washingtonpost.com | 2023-12-04 spectrum-git-hotfix-pinocchios.preview.now.washingtonpost.com | 2023-12-04 recipe-admin-git-food-46-1.preview.now.washingtonpost.com | 2023-12-04 wpds-ui-kit-git-dark-mode-bugs.preview.now.washingtonpost.com | 2023-12-04 wapo-homepage-dr-hannahmahon.preview.now.washingtonpost.com | 2023-12-04 homepage-git-fix-update-cdn-link.preview.now.washingtonpost.com | 2023-12-04 spectrum-sandbox-git-spect-2672.preview.now.washingtonpost.com | 2023-12-04 site-components-git-aa-update.preview.now.washingtonpost.com | 2023-12-04 subs-storybook-git-fix-peer-dep.preview.now.washingtonpost.com | 2023-12-04 wpaa-git-hotfix-hardn-the-forms-3.preview.now.washingtonpost.com | 2023-12-04 wpds-ui-kit-git-logo-asset-title.preview.now.washingtonpost.com | 2023-12-04 wapo-careers-git-hyps-453.preview.now.washingtonpost.com | 2023-12-04 homepage-git-wfo-5606-live-image.preview.now.washingtonpost.com | 2023-12-04 my-post-git-tetrooffersswitchback.preview.now.washingtonpost.com | 2023-12-04 wpds-ui-kit-git-next-remote-watch.preview.now.washingtonpost.com | 2023-12-04 spectrum-git-spect-2240-cl-img.preview.now.washingtonpost.com | 2023-12-04 wpds-ui-kit-git-app-bar.preview.now.washingtonpost.com | 2023-12-01 wpds-ui-kit-git-checkbox.preview.now.washingtonpost.com | 2023-12-01 wpaa-git-conflict-qa-apple-tos.preview.now.washingtonpost.com | 2023-12-01 spectrum-git-spect-1553.preview.now.washingtonpost.com | 2023-12-01 spectrum-sandbox-git-rc-1-65.preview.now.washingtonpost.com | 2023-12-01 videos-nextjs.preview.now.washingtonpost.com | 2023-11-30 wp-fusion-git-wfo-4477-ab-test.preview.now.washingtonpost.com | 2023-11-30 wp-fusion-git-wfo-4515-set-cookie.preview.now.washingtonpost.com | 2023-11-30 wpds-ui-kit-vitejs-example.preview.now.washingtonpost.com | 2023-11-30 wpds-ui-kit-vitejs-v2-example.preview.now.washingtonpost.com | 2023-11-30 wpds-ui-kit-viteks-v2-example.preview.now.washingtonpost.com | 2023-11-30 spectrum-sandbox-git-spect-1526.preview.now.washingtonpost.com | 2023-11-30 spectrum-git-fix-osn-styling.preview.now.washingtonpost.com | 2023-11-30 subs-fe-quiz-git-qa.preview.now.washingtonpost.com | 2023-11-30 spectrum-git-play-47.preview.now.washingtonpost.com | 2023-11-30 spectrum-sandbox-git-play-47.preview.now.washingtonpost.com | 2023-11-30 subs-fe-quiz-git-refactor-pages.preview.now.washingtonpost.com | 2023-11-30 spectrum-git-spect-3562.preview.now.washingtonpost.com | 2023-11-30 spectrum-sandbox-git-spect-3562.preview.now.washingtonpost.com | 2023-11-30 assembler-git-hcourt-fix-foryou.preview.now.washingtonpost.com | 2023-11-30 wpds-ui-kit-storybook-git-dialog.preview.now.washingtonpost.com | 2023-11-30 wpds-ui-kit-git-dialog.preview.now.washingtonpost.com | 2023-11-30 videos-nextjs-git-play-595.preview.now.washingtonpost.com | 2023-11-30 subs-fe-quiz-git-feat-latest.preview.now.washingtonpost.com | 2023-11-30 spectrum-git-wfo-6111-cardify.preview.now.washingtonpost.com | 2023-11-30 media-components-app-git-play-47.preview.now.washingtonpost.com | 2023-11-30 subs-fe-quiz-git-preproduction.preview.now.washingtonpost.com | 2023-11-30

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

Related screenshots
Screenshots of pages that talked to this domain

WHOIS for washingtonpost.com

Domain Name: washingtonpost.com
Registry Domain ID: 1707992_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.corporatedomains.com
Registrar URL: www.cscprotectsbrands.com
Updated Date: 2023-11-08T01:08:35Z
Creation Date: 1995-11-13T00:00:00Z
Registrar Registration Expiration Date: 2024-11-12T05:00:00Z
Registrar: CSC CORPORATE DOMAINS, INC.
Sponsoring Registrar IANA ID: 299
Registrar Abuse Contact Email: domainabuse@cscglobal.com
Registrar Abuse Contact Phone: +1.8887802723
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: serverDeleteProhibited http://www.icann.org/epp#serverDeleteProhibited
Domain Status: serverTransferProhibited http://www.icann.org/epp#serverTransferProhibited
Domain Status: serverUpdateProhibited http://www.icann.org/epp#serverUpdateProhibited
Registry Registrant ID: 
Registrant Name: Domain Administrator
Registrant Organization: WP Company LLC
Registrant Street: 1301 K Street, NW
Registrant City: Washington
Registrant State/Province: DC
Registrant Postal Code: 20071
Registrant Country: US
Registrant Phone: +1.2023347868
Registrant Phone Ext: 
Registrant Fax: +1.2023345075
Registrant Fax Ext: 
Registrant Email: admin.contact@digitalink.com
Registry Admin ID: 
Admin Name: Domain Administrator
Admin Organization: WP Company LLC
Admin Street: 1301 K Street, NW
Admin City: Washington
Admin State/Province: DC
Admin Postal Code: 20071
Admin Country: US
Admin Phone: +1.2023347868
Admin Phone Ext: 
Admin Fax: +1.2023345075
Admin Fax Ext: 
Admin Email: admin.contact@digitalink.com
Registry Tech ID: 
Tech Name: Administrative Technical Contact
Tech Organization: WP Company LLC
Tech Street: 1301 K Street, NW
Tech City: Washington
Tech State/Province: DC
Tech Postal Code: 20071
Tech Country: US
Tech Phone: +1.2023344530
Tech Phone Ext: 
Tech Fax: +1.2023345075
Tech Fax Ext: 
Tech Email: tech.contact@digitalink.com
Name Server: ns-666.awsdns-19.net
Name Server: ns-404.awsdns-50.com
Name Server: sdns34.ultradns.com
Name Server: sdns34.ultradns.net
Name Server: ns-1027.awsdns-00.org
Name Server: sdns34.ultradns.org
Name Server: ns-1840.awsdns-38.co.uk
Name Server: sdns34.ultradns.biz
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2023-11-08T01:08:35Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Corporation Service Company(c) (CSC)  The Trusted Partner of More than 50% of the 100 Best Global Brands.

Contact us to learn more about our enterprise solutions for Global Domain Name Registration and Management, Trademark Research and Watching, Brand, Logo and Auction Monitoring, as well SSL Certificate Services and DNS Hosting.

NOTICE: You are not authorized to access or query our WHOIS database through the use of high-volume, automated, electronic processes or for the purpose or purposes of using the data in any manner that violates these terms of use. The Data in the CSC WHOIS database is provided by CSC for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. CSC does not guarantee its accuracy. By submitting a WHOIS query, you agree to abide by the following terms of use: you agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via direct mail, e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to CSC (or its computer systems). CSC reserves the right to terminate your access to the WHOIS database in its sole discretion for any violations by you of these terms of use. CSC reserves the right to modify these terms at any time.

Register your domain name at http://www.cscglobal.com