xggnt.mjt.lu
GOOGLE-CLOUD-PLATFORM, US

Seen 60 times between October 6th, 2023 and March 27th, 2024.

General Info Open in Search

Geo	Brussels, Belgium (BE) —
Domain	mjt.lu (The registered domain)
AS	AS396982 - GOOGLE-CLOUD-PLATFORM, US Note: An IP might be announced by multiple ASs. This is not shown.
Route	35.240.0.0/15 (Route of ASN)
PTR	140.186.241.35.bc.googleusercontent.com(PTR record of primary IP)
IPv4	35.241.186.140

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

Direct hits
Summary of pages hosted on this domain

IPs 35.241.186.140 | 26x

Domains xggnt.mjt.lu | 26x

Recent scans (26 total) Show all

URL	Age	Size		IPs
xggnt.mjt.lu/lnk/aukaace0cewaaciadvqaarsrkwyaaycsf-aanmghabobjqblies0rrlptzqg...	8 months	319 B	2	1	1
xggnt.mjt.lu/lnk/AMcAACeDC0MAAciAdUIAARSrARIAAYCsF-AAnMgHABObjQBlIDuSr4vd8vB1...	a year	279 B	1	1	1
xggnt.mjt.lu	a year	3 KB	2	2	2
xggnt.mjt.lu/lnk/AU0AACeFDnMAAciAdUIAANySCPkAAYCsF-AAnMgHABObjQBlICtFZOr6qLQP...	a year	279 B	1	1	1
xggnt.mjt.lu/lnk/AU0AACeFDnMAAciAdUIAANySCPkAAYCsF-AAnMgHABObjQBlICtFZOr6qLQP...	a year	279 B	1	1	1

Incoming hits
Summary of pages that talked to this domain

ASNs AS24940 | 32x AS51167 | 2x

IPs 94.130.10.89 | 32x 89.117.53.247 | 2x

Domains login-openseaitems.ddnss.eu | 22x portfoliometamask-io.ddnss.eu | 12x

Countries DE | 34x

Recent scans (34 total) Show all

URL	Age	Size		IPs
login-openseaitems.ddnss.eu/drops/rankings/	a year	1 KB	2	2	3
login-openseaitems.ddnss.eu/drops/rankings/	a year	1 KB	2	2	3
login-openseaitems.ddnss.eu/drops/rankings/	a year	1 KB	2	2	3
portfoliometamask-io.ddnss.eu/FMfcgzGtxSvtnDMJWSGhxLTztxLkJkMW/FMfcgzGtxSxDgR...	a year	170 KB	18	4	3
portfoliometamask-io.ddnss.eu/FMfcgzGtxSvtnDMJWSGhxLTztxLkJkMW/FMfcgzGtxSxDgR...	a year	170 KB	18	4	3

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recent screenshots
Screenshots of pages hosted on this domain

Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to

IPs 35.241.186.140 | 26x

Domains xggnt.mjt.lu | 26x

Related screenshots
Screenshots of pages that talked to this domain

DNS recordsRetrieved via DNS ANY query

A	35.241.186.140 (TTL: 60)
TXT	v=DKIM1; p=
TXT	v=spf1 -all

WHOIS for xggnt.mjt.lu


domainname:     mjt.lu
domaintype:     ACTIVE
nserver:        ns1.mljt.tech
nserver:        ns0.mljt.tech
nserver:        ns2.mljt.tech
ownertype:      ORGANISATION
org-country:    FR
registrar-name:         OVH
registrar-email:        support@ovh.com
registrar-url:          http://www.ovh.lu
registrar-country:      FR

whois-web:         https://www.dns.lu/en/support/domainname-availability/whois-gateway/

xggnt.mjt.lu GOOGLE-CLOUD-PLATFORM, US