www.gary.gray.clara.net Open in urlscan Pro
195.8.66.21 Public Scan

Go To Rescan
Add Verdict Report

URL:
http://www.gary.gray.clara.net//reviews//battleroyale.htm
Submission: On July 21 via api (July 21st 2024, 3:14:16 pm UTC) from US — Scanned from GB

Summary HTTP 35 Redirects Behaviour Indicators

Summary

This website contacted 5 IPs in 3 countries across 7 domains to perform 35 HTTP transactions. The main IP is 195.8.66.21, located in United Kingdom and belongs to CLARANET-AS ClaraNET LTD, GB. The main domain is www.gary.gray.clara.net.

This is the only time www.gary.gray.clara.net was scanned on urlscan.io!

urlscan.io Verdict: No classification

Domain & IP information

	IP Address	AS Autonomous System
16	195.8.66.21 195.8.66.21	8426 (CLARANET-...) (CLARANET-AS ClaraNET LTD)
1	2a02:fa8:8806... 2a02:fa8:8806:20::2100	41041 (VCLK-EU-SE) (VCLK-EU-SE)
1 2	198.50.213.200 198.50.213.200	16276 (OVH) (OVH)
2	2a02:fa8:8806... 2a02:fa8:8806:12::1460	41041 (VCLK-EU-SE) (VCLK-EU-SE)
35	5

16 195.8.66.21 (United Kingdom)

ASN8426 (CLARANET-AS ClaraNET LTD, GB)
PTR: home.clara.net

www.gary.gray.clara.net	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 2a02:fa8:8806:20::2100 (Singapore)

ASN41041 (VCLK-EU-SE, US)

media.fastclick.net	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 198.50.213.200 (Canada) 1 redirects

ASN16276 (OVH, FR)
PTR: afsanalytics.com

www.addfreestats.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools
www.afsanalytics.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 2a02:fa8:8806:12::1460 (Singapore)

ASN41041 (VCLK-EU-SE, US)

media.fastclick.net	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

	Apex Domain Subdomains	Transfer
16	clara.net www.gary.gray.clara.net	41 KB
3	fastclick.net media.fastclick.net — Cisco Umbrella Rank: 215922
1	afsanalytics.com www.afsanalytics.com	2 KB
1	addfreestats.com 1 redirects www.addfreestats.com	375 B
0	thezreview.co.uk Failed www.thezreview.co.uk Failed
0	allposters.com Failed images.allposters.com Failed
0	popuptraffic.com Failed www.popuptraffic.com Failed
35	7

	Domain	Requested by
16	www.gary.gray.clara.net	www.gary.gray.clara.net
3	media.fastclick.net	www.gary.gray.clara.net
1	www.afsanalytics.com	www.gary.gray.clara.net
1	www.addfreestats.com	1 redirects
0	www.thezreview.co.uk Failed
0	images.allposters.com Failed	www.gary.gray.clara.net
0	www.popuptraffic.com Failed	www.gary.gray.clara.net
35	7

This site contains no links.

Subject Issuer	Validity	Valid

This page contains 3 frames:

Frame: http://www.thezreview.co.uk/
Frame ID: 841B4E222ABAB0B493D193D1A2F19EEF
Requests: 36 HTTP requests in this frame

Frame: http://media.fastclick.net/w/get.media?t=s&sid=1984&m=1&f=a&v=1.2&c=168&j=1600|1200|||||N|Y|&r=&d=f
Frame ID: 46990D23C967E955D89BDBCD14C19BD8
Requests: 1 HTTP requests in this frame

Frame: http://media.fastclick.net/w/get.media?t=n&sid=1984&m=3&f=b&v=1.4&c=3086&r=&d=f
Frame ID: 49662AD57CFC8FD885667268A969A0BD
Requests: 1 HTTP requests in this frame

Screenshot
Live screenshot

Full Image

Page Title

www.thezreview.co.uk

Page URL History Show full URLs

http://www.gary.gray.clara.net//reviews//battleroyale.htm HTTP 307
https://www.gary.gray.clara.net//reviews//battleroyale.htm HTTP 307
http://www.gary.gray.clara.net//reviews//battleroyale.htm Page URL

Page Statistics

35
Requests

0 %
HTTPS

50 %
IPv6

7
Domains

7
Subdomains

5
IPs

3
Countries

43 kB
Transfer

64 kB
Size

3
Cookies

0 Outgoing links

These are links going to different origins than the main page.

Page URL History

This captures the URL locations of the websites, including HTTP redirects and client-side redirects via JavaScript or Meta fields.

http://www.gary.gray.clara.net//reviews//battleroyale.htm HTTP 307
https://www.gary.gray.clara.net//reviews//battleroyale.htm HTTP 307
http://www.gary.gray.clara.net//reviews//battleroyale.htm Page URL

Redirected requests

There were HTTP redirect chains for the following requests:

Request Chain 19

http://www.addfreestats.com/cgi-bin/connect.cgi?usr=00028361P000&refer=&tips=0.9087415501770169 HTTP 301
https://www.afsanalytics.com/cgi-bin/connect.cgi?usr=00028361P000&refer=&tips=0.9087415501770169

Request Chain 31

http://www.thezreview.co.uk/ HTTP 307
https://www.thezreview.co.uk/ HTTP 307
http://www.thezreview.co.uk/

35 HTTP transactions
3 data transactions

Method Protocol	Status	Resource Path	Size x-fer	Time Latency	Type MIME-Type	IP Location
GET H/1.1	200 OK	Primary Request battleroyale.htm Show response www.gary.gray.clara.net//reviews// Redirect Chain http://www.gary.gray.clara.net//reviews//battleroyale.htm https://www.gary.gray.clara.net//reviews//battleroyale.htm http://www.gary.gray.clara.net//reviews//battleroyale.htm	25 KB 7 KB	39ms 38ms	Document text/html	195.8.66.21 CLARANET-AS Clara...
General Check archive.org Show headers Download Go to Full URL http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 195.8.66.21 , United Kingdom, ASN8426 (CLARANET-AS ClaraNET LTD, GB), Reverse DNS home.clara.net Software Apache / Resource Hash `0fb66f3d6d9274c25f3b4dcc213da715f9d1016ad96d4df8a4d743e9a9f64fd4` Request headers Upgrade-Insecure-Requests 1 User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Accept-Ranges bytes Connection close Content-Encoding gzip Content-Length 6799 Content-Type text/html Date Sun, 21 Jul 2024 15:14:11 GMT ETag "807e5b7a0000663a-6384-3af18af85f640-gzip" Last-Modified Sun, 10 Nov 2002 16:24:49 GMT Server Apache Vary Host,Accept-Encoding Redirect headers Location http://www.gary.gray.clara.net//reviews//battleroyale.htm Non-Authoritative-Reason HttpsUpgrades
GET		assign.php www.popuptraffic.com/	0 0

GET		assign.php www.popuptraffic.com/	0 0

GET H/1.1	200 OK	newgraphicstemplatenavhome.gif www.gary.gray.clara.net/images/	4 KB 4 KB	54ms 30ms	Image image/gif	195.8.66.21 CLARANET-AS Clara...
General Check archive.org Show headers Download Go to Show image Full URL http://www.gary.gray.clara.net/images/newgraphicstemplatenavhome.gif Requested by Host: www.gary.gray.clara.net URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 195.8.66.21 , United Kingdom, ASN8426 (CLARANET-AS ClaraNET LTD, GB), Reverse DNS home.clara.net Software Apache / Resource Hash `7907c70246d6d76d9dff9c824f4908a7da5749825fe15c8342a3bb3c44276057` Request headers Referer http://www.gary.gray.clara.net//reviews//battleroyale.htm User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Date Sun, 21 Jul 2024 15:14:11 GMT Last-Modified Sat, 03 Nov 2001 21:14:16 GMT Server Apache ETag "807e5b7a00007781-fb3-391e15db5da00" Vary Host Content-Type image/gif Connection close Accept-Ranges bytes Content-Length 4019
GET H/1.1	200 OK	newgraphicstemplatenavnews.gif www.gary.gray.clara.net/images/	2 KB 2 KB	55ms 28ms	Image image/gif	195.8.66.21 CLARANET-AS Clara...
General Check archive.org Show headers Download Go to Show image Full URL http://www.gary.gray.clara.net/images/newgraphicstemplatenavnews.gif Requested by Host: www.gary.gray.clara.net URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 195.8.66.21 , United Kingdom, ASN8426 (CLARANET-AS ClaraNET LTD, GB), Reverse DNS home.clara.net Software Apache / Resource Hash `06a4967ad32b4a2e88d2fe49d12f81ad667eddf2a788f9ca1a56faf9b2bc87c9` Request headers Referer http://www.gary.gray.clara.net//reviews//battleroyale.htm User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Date Sun, 21 Jul 2024 15:14:12 GMT Last-Modified Sat, 03 Nov 2001 21:14:23 GMT Server Apache ETag "807e5b7a00007783-7b3-391e15e20a9c0" Vary Host Content-Type image/gif Connection close Accept-Ranges bytes Content-Length 1971
GET H/1.1	200 OK	newgraphicstemplatenavcomingsoon.gif www.gary.gray.clara.net/images/	2 KB 2 KB	104ms 27ms	Image image/gif	195.8.66.21 CLARANET-AS Clara...
General Check archive.org Show headers Download Go to Show image Full URL http://www.gary.gray.clara.net/images/newgraphicstemplatenavcomingsoon.gif Requested by Host: www.gary.gray.clara.net URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 195.8.66.21 , United Kingdom, ASN8426 (CLARANET-AS ClaraNET LTD, GB), Reverse DNS home.clara.net Software Apache / Resource Hash `5dfc91d1ec7acb15b92a444093b062234b8174c29238fa315778c4ecc3df673c` Request headers Referer http://www.gary.gray.clara.net//reviews//battleroyale.htm User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Date Sun, 21 Jul 2024 15:14:12 GMT Last-Modified Sat, 03 Nov 2001 21:13:50 GMT Server Apache ETag "807e5b7a0000372c-6ad-391e15c291f80" Vary Host Content-Type image/gif Connection close Accept-Ranges bytes Content-Length 1709
GET H/1.1	200 OK	newgraphicstemplatenavreviews.gif www.gary.gray.clara.net/images/	1 KB 2 KB	108ms 29ms	Image image/gif	195.8.66.21 CLARANET-AS Clara...
General Check archive.org Show headers Download Go to Show image Full URL http://www.gary.gray.clara.net/images/newgraphicstemplatenavreviews.gif Requested by Host: www.gary.gray.clara.net URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 195.8.66.21 , United Kingdom, ASN8426 (CLARANET-AS ClaraNET LTD, GB), Reverse DNS home.clara.net Software Apache / Resource Hash `eb9fab55222f5c0487709774870df886d480f2826a236fc49a83889e58de1adb` Request headers Referer http://www.gary.gray.clara.net//reviews//battleroyale.htm User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Date Sun, 21 Jul 2024 15:14:12 GMT Last-Modified Sat, 03 Nov 2001 21:14:35 GMT Server Apache ETag "807e5b7a00007788-5ae-391e15ed7c4c0" Vary Host Content-Type image/gif Connection close Accept-Ranges bytes Content-Length 1454
GET H/1.1	200 OK	newgraphicstemplatenavtrailers.gif www.gary.gray.clara.net/images/	1 KB 2 KB	121ms 30ms	Image image/gif	195.8.66.21 CLARANET-AS Clara...
General Check archive.org Show headers Download Go to Show image Full URL http://www.gary.gray.clara.net/images/newgraphicstemplatenavtrailers.gif Requested by Host: www.gary.gray.clara.net URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 195.8.66.21 , United Kingdom, ASN8426 (CLARANET-AS ClaraNET LTD, GB), Reverse DNS home.clara.net Software Apache / Resource Hash `50e21e6d8f27f19cc64a443fc4cf38de749fc03695172a707125fec085a74880` Request headers Referer http://www.gary.gray.clara.net//reviews//battleroyale.htm User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Date Sun, 21 Jul 2024 15:14:12 GMT Last-Modified Sat, 03 Nov 2001 21:14:41 GMT Server Apache ETag "807e5b7a0000778a-518-391e15f335240" Vary Host Content-Type image/gif Connection close Accept-Ranges bytes Content-Length 1304
GET H/1.1	200 OK	newgraphicstemplatenavdvd.gif www.gary.gray.clara.net/images/	881 B 1 KB	123ms 30ms	Image image/gif	195.8.66.21 CLARANET-AS Clara...
General Check archive.org Show headers Download Go to Show image Full URL http://www.gary.gray.clara.net/images/newgraphicstemplatenavdvd.gif Requested by Host: www.gary.gray.clara.net URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 195.8.66.21 , United Kingdom, ASN8426 (CLARANET-AS ClaraNET LTD, GB), Reverse DNS home.clara.net Software Apache / Resource Hash `6ca4b5d8d49dea00cb9ff052328a16949b1cdc179e9e5710a935edf1e305d13c` Request headers Referer http://www.gary.gray.clara.net//reviews//battleroyale.htm User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Date Sun, 21 Jul 2024 15:14:12 GMT Last-Modified Sat, 03 Nov 2001 21:14:02 GMT Server Apache ETag "807e5b7a0000373b-371-391e15ce03a80" Vary Host Content-Type image/gif Connection close Accept-Ranges bytes Content-Length 881
GET H/1.1	200 OK	newgraphicstemplatenavfeatures.gif www.gary.gray.clara.net/images/	1 KB 2 KB	153ms 29ms	Image image/gif	195.8.66.21 CLARANET-AS Clara...
General Check archive.org Show headers Download Go to Show image Full URL http://www.gary.gray.clara.net/images/newgraphicstemplatenavfeatures.gif Requested by Host: www.gary.gray.clara.net URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 195.8.66.21 , United Kingdom, ASN8426 (CLARANET-AS ClaraNET LTD, GB), Reverse DNS home.clara.net Software Apache / Resource Hash `29d316a4b401896369574886a5a01e2fab3bfbdf5fd55f90b7e643ac75b71b36` Request headers Referer http://www.gary.gray.clara.net//reviews//battleroyale.htm User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Date Sun, 21 Jul 2024 15:14:12 GMT Last-Modified Sat, 03 Nov 2001 21:14:07 GMT Server Apache ETag "807e5b7a0000777f-594-391e15d2c85c0" Vary Host Content-Type image/gif Connection close Accept-Ranges bytes Content-Length 1428
GET H/1.1	200 OK	newgraphicstemplatenavcommunity.gif www.gary.gray.clara.net/images/	2 KB 2 KB	37ms 27ms	Image image/gif	195.8.66.21 CLARANET-AS Clara...
General Check archive.org Show headers Download Go to Show image Full URL http://www.gary.gray.clara.net/images/newgraphicstemplatenavcommunity.gif Requested by Host: www.gary.gray.clara.net URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 195.8.66.21 , United Kingdom, ASN8426 (CLARANET-AS ClaraNET LTD, GB), Reverse DNS home.clara.net Software Apache / Resource Hash `7dfbfc815cf9b1ca5c22848c80444aefee62c9baa9ba1d4cbe8c8200c8a49294` Request headers Referer http://www.gary.gray.clara.net//reviews//battleroyale.htm User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Date Sun, 21 Jul 2024 15:14:12 GMT Last-Modified Sat, 03 Nov 2001 21:13:56 GMT Server Apache ETag "807e5b7a00003739-6ce-391e15c84ad00" Vary Host Content-Type image/gif Connection close Accept-Ranges bytes Content-Length 1742
GET H/1.1	200 OK	newgraphicstemplatenavresource.gif www.gary.gray.clara.net/images/	1 KB 2 KB	38ms 27ms	Image image/gif	195.8.66.21 CLARANET-AS Clara...
General Check archive.org Show headers Download Go to Show image Full URL http://www.gary.gray.clara.net/images/newgraphicstemplatenavresource.gif Requested by Host: www.gary.gray.clara.net URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 195.8.66.21 , United Kingdom, ASN8426 (CLARANET-AS ClaraNET LTD, GB), Reverse DNS home.clara.net Software Apache / Resource Hash `1b74c67700ab6b82142187a712d151cb5d9b7eb7a43c4591f2bd0a09ab725a64` Request headers Referer http://www.gary.gray.clara.net//reviews//battleroyale.htm User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Date Sun, 21 Jul 2024 15:14:12 GMT Last-Modified Sat, 03 Nov 2001 21:14:29 GMT Server Apache ETag "807e5b7a00007786-5e5-391e15e7c3740" Vary Host Content-Type image/gif Connection close Accept-Ranges bytes Content-Length 1509
GET H/1.1	200 OK	newgraphicsleftnavbottom.gif www.gary.gray.clara.net/images/	1 KB 1 KB	43ms 32ms	Image image/gif	195.8.66.21 CLARANET-AS Clara...
General Check archive.org Show headers Download Go to Show image Full URL http://www.gary.gray.clara.net/images/newgraphicsleftnavbottom.gif Requested by Host: www.gary.gray.clara.net URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 195.8.66.21 , United Kingdom, ASN8426 (CLARANET-AS ClaraNET LTD, GB), Reverse DNS home.clara.net Software Apache / Resource Hash `4ba70fe515cbc8fd52779fc56786baf47c1c64891454ff67b81395909577db0c` Request headers Referer http://www.gary.gray.clara.net//reviews//battleroyale.htm User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Date Sun, 21 Jul 2024 15:14:12 GMT Last-Modified Sat, 03 Nov 2001 21:13:28 GMT Server Apache ETag "807e5b7a00003726-437-391e15ad96e00" Vary Host Content-Type image/gif Connection close Accept-Ranges bytes Content-Length 1079
GET H/1.1	200 OK	newgraphicsreviewsbanner.gif www.gary.gray.clara.net/images/	9 KB 9 KB	53ms 29ms	Image image/gif	195.8.66.21 CLARANET-AS Clara...
General Check archive.org Show headers Download Go to Show image Full URL http://www.gary.gray.clara.net/images/newgraphicsreviewsbanner.gif Requested by Host: www.gary.gray.clara.net URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 195.8.66.21 , United Kingdom, ASN8426 (CLARANET-AS ClaraNET LTD, GB), Reverse DNS home.clara.net Software Apache / Resource Hash `a9e4c87f9572043819998f9f3081e80ed956c71a537960920d49514bfa39e6d1` Request headers Referer http://www.gary.gray.clara.net//reviews//battleroyale.htm User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Date Sun, 21 Jul 2024 15:14:11 GMT Last-Modified Sat, 03 Nov 2001 21:13:45 GMT Server Apache ETag "807e5b7a00003729-2336-391e15bdcd440" Vary Host Content-Type image/gif Connection close Accept-Ranges bytes Content-Length 9014
GET H/1.1	200 OK	leftcornerright.gif www.gary.gray.clara.net/images/	178 B 438 B	82ms 30ms	Image image/gif	195.8.66.21 CLARANET-AS Clara...
General Check archive.org Show headers Download Go to Show image Full URL http://www.gary.gray.clara.net/images/leftcornerright.gif Requested by Host: www.gary.gray.clara.net URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 195.8.66.21 , United Kingdom, ASN8426 (CLARANET-AS ClaraNET LTD, GB), Reverse DNS home.clara.net Software Apache / Resource Hash `1b135e23647d04c48e65f2cb86e2cef9772e9b645207b4efc6c1653f1ae5e737` Request headers Referer http://www.gary.gray.clara.net//reviews//battleroyale.htm User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Date Sun, 21 Jul 2024 15:14:12 GMT Last-Modified Sun, 09 Sep 2001 21:17:06 GMT Server Apache ETag "807e5b7a00005c87-b2-38d8efe923880" Vary Host Content-Type image/gif Connection close Accept-Ranges bytes Content-Length 178
GET H/1.1	200 OK	rightcornerbottom.gif www.gary.gray.clara.net/images/	179 B 439 B	87ms 27ms	Image image/gif	195.8.66.21 CLARANET-AS Clara...
General Check archive.org Show headers Download Go to Show image Full URL http://www.gary.gray.clara.net/images/rightcornerbottom.gif Requested by Host: www.gary.gray.clara.net URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 195.8.66.21 , United Kingdom, ASN8426 (CLARANET-AS ClaraNET LTD, GB), Reverse DNS home.clara.net Software Apache / Resource Hash `f56823814ae441d99f6e8d7c6bd60523a2148f681466bfa907c542de4ebde7a3` Request headers Referer http://www.gary.gray.clara.net//reviews//battleroyale.htm User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Date Sun, 21 Jul 2024 15:14:12 GMT Last-Modified Sun, 14 Oct 2001 17:04:16 GMT Server Apache ETag "807e5b7a00006ad0-b3-3904b8ad08400" Vary Host Content-Type image/gif Connection close Accept-Ranges bytes Content-Length 179
GET H/1.1	200 OK	newgraphicsbannerrighttop.gif www.gary.gray.clara.net/images/	3 KB 3 KB	36ms 28ms	Image image/gif	195.8.66.21 CLARANET-AS Clara...
General Check archive.org Show headers Download Go to Show image Full URL http://www.gary.gray.clara.net/images/newgraphicsbannerrighttop.gif Requested by Host: www.gary.gray.clara.net URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 195.8.66.21 , United Kingdom, ASN8426 (CLARANET-AS ClaraNET LTD, GB), Reverse DNS home.clara.net Software Apache / Resource Hash `fd912a8f61a5b1418fc195f950efbf830184b8a3499e3bd20d58782870660990` Request headers Referer http://www.gary.gray.clara.net//reviews//battleroyale.htm User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Date Sun, 21 Jul 2024 15:14:12 GMT Last-Modified Sat, 03 Nov 2001 21:12:56 GMT Server Apache ETag "807e5b7a00006160-b9d-391e158f12600" Vary Host Content-Type image/gif Connection close Accept-Ranges bytes Content-Length 2973
GET		039_oceans11_red_double_sided_a.jpg images.allposters.com/images/118/	0 0

GET H/1.1	200 OK	newgraphicsrightnavbottom.gif www.gary.gray.clara.net/images/	1 KB 1 KB	43ms 32ms	Image image/gif	195.8.66.21 CLARANET-AS Clara...
General Check archive.org Show headers Download Go to Show image Full URL http://www.gary.gray.clara.net/images/newgraphicsrightnavbottom.gif Requested by Host: www.gary.gray.clara.net URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 195.8.66.21 , United Kingdom, ASN8426 (CLARANET-AS ClaraNET LTD, GB), Reverse DNS home.clara.net Software Apache / Resource Hash `616d8319bb0ae629a743e1d595debc91f738fc7125b40a92b5b31e10eec6d6fd` Request headers Referer http://www.gary.gray.clara.net//reviews//battleroyale.htm User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Date Sun, 21 Jul 2024 15:14:12 GMT Last-Modified Sat, 03 Nov 2001 21:13:47 GMT Server Apache ETag "807e5b7a0000372a-417-391e15bfb58c0" Vary Host Content-Type image/gif Connection close Accept-Ranges bytes Content-Length 1047
GET H/1.1	404 Not Found	pop.cgi media.fastclick.net/w/	0 0	105ms 29ms	Script text/plain	2a02:fa8:8806:20::2100 VCLK-EU-SE
General Check archive.org Show headers Download Go to Full URL http://media.fastclick.net/w/pop.cgi?sid=1984&m=2&v=1.7e&u=http%3A//www.gary.gray.clara.net//reviews//battleroyale.htm&c=11 Requested by Host: www.gary.gray.clara.net URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 2a02:fa8:8806:20::2100 , Singapore, ASN41041 (VCLK-EU-SE, US), Reverse DNS Software nginx / Resource Hash Request headers Referer http://www.gary.gray.clara.net/ User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Intervention <https://www.chromestatus.com/feature/5718547946799104>; level="warning" Response headers Date Sun, 21 Jul 2024 15:14:12 GMT Cache-Control max-age=0, no-store Server nginx Connection keep-alive Content-Length 0
GET H/1.1	200 OK	connect.cgi www.afsanalytics.com/cgi-bin/ Redirect Chain http://www.addfreestats.com/cgi-bin/connect.cgi?usr=00028361P000&refer=&tips=0.9087415501770169 https://www.afsanalytics.com/cgi-bin/connect.cgi?usr=00028361P000&refer=&tips=0.9087415501770169	2 KB 2 KB	1018ms 417ms	Image image/gif	198.50.213.200 OVH
General Check archive.org Show headers Download Go to Show image Full URL https://www.afsanalytics.com/cgi-bin/connect.cgi?usr=00028361P000&refer=&tips=0.9087415501770169 Requested by Host: www.gary.gray.clara.net URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 198.50.213.200 , Canada, ASN16276 (OVH, FR), Reverse DNS afsanalytics.com Software Apache / Resource Hash `d7a6becc3e77680b2cab64738ae22dd6b7bdcaa75f30cd0f18a0287df2324aa6` Request headers Referer http://www.gary.gray.clara.net/ User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Date Sun, 21 Jul 2024 15:14:13 GMT Content-Encoding gzip Server Apache Access-Control-Max-Age 3600 Access-Control-Allow-Methods GET, POST, PUT, DELETE, OPTIONS P3P CP="ADMa OUR UNI NID DSP NOI COR" Access-Control-Allow-Origin * Content-Type image/gif Cache-Control max-age=0 Vary Accept-Encoding,User-Agent Connection Keep-Alive Access-Control-Allow-Headers X-Forwarded-For, Forwarded-For, X-Client-IP, Client-IP, X-Real-IP, X-Requested-With, Content-Type,withCredentials Content-Length 1408 Keep-Alive timeout=15 Expires Sun, 21 Jul 2024 15:14:13 GMT Redirect headers Date Sun, 21 Jul 2024 15:14:12 GMT Server Apache Content-Type text/html; charset=iso-8859-1 Location https://www.afsanalytics.com/cgi-bin/connect.cgi?usr=00028361P000&refer=&tips=0.9087415501770169 Cache-Control max-age=0 Connection Keep-Alive Keep-Alive timeout=15 Content-Length 312 Expires Sun, 21 Jul 2024 15:14:12 GMT
GET H/1.1	204 No Content	get.media media.fastclick.net/w/ Frame 4699	0 0	59ms 32ms	Document text/html	2a02:fa8:8806:12::1460 VCLK-EU-SE
General Check archive.org Show headers Download Go to Full URL http://media.fastclick.net/w/get.media?t=s&sid=1984&m=1&f=a&v=1.2&c=168&j=1600\|1200\|\|\|\|\|N\|Y\|&r=&d=f Requested by Host: www.gary.gray.clara.net URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 2a02:fa8:8806:12::1460 , Singapore, ASN41041 (VCLK-EU-SE, US), Reverse DNS Software nginx / Resource Hash Request headers Referer http://www.gary.gray.clara.net/ Upgrade-Insecure-Requests 1 User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Accept-CH Sec-CH-UA-Platform-Version,Sec-CH-UA-Arch,Sec-CH-UA-Model,Sec-CH-UA-Bitness Cache-Control no-cache Connection keep-alive Content-Type text/html Date Sun, 21 Jul 2024 15:14:12 GMT Expires 0 Pragma no-cache Server nginx
GET H/1.1	204 No Content	get.media media.fastclick.net/w/ Frame 4966	0 0	60ms 31ms	Document text/html	2a02:fa8:8806:12::1460 VCLK-EU-SE
General Check archive.org Show headers Download Go to Full URL http://media.fastclick.net/w/get.media?t=n&sid=1984&m=3&f=b&v=1.4&c=3086&r=&d=f Requested by Host: www.gary.gray.clara.net URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm Protocol HTTP/1.1 Server 2a02:fa8:8806:12::1460 , Singapore, ASN41041 (VCLK-EU-SE, US), Reverse DNS Software nginx / Resource Hash Request headers Referer http://www.gary.gray.clara.net/ Upgrade-Insecure-Requests 1 User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Accept-CH Sec-CH-UA-Platform-Version,Sec-CH-UA-Arch,Sec-CH-UA-Model,Sec-CH-UA-Bitness Cache-Control no-cache Connection keep-alive Content-Type text/html Date Sun, 21 Jul 2024 15:14:12 GMT Expires 0 Pragma no-cache Server nginx
GET		newgraphicstemplatenavhome2.gif www.gary.gray.clara.net/images/	0 0

GET		newgraphicstemplatenavnews2.gif www.gary.gray.clara.net/images/	0 0

GET		newgraphicstemplatenavcomingsoon2.gif www.gary.gray.clara.net/images/	0 0

GET		newgraphicstemplatenavreviews2.gif www.gary.gray.clara.net/images/	0 0

GET		newgraphicstemplatenavtrailers2.gif www.gary.gray.clara.net/images/	0 0

GET		newgraphicstemplatenavdvd2.gif www.gary.gray.clara.net/images/	0 0

GET		newgraphicstemplatenavfeatures2.gif www.gary.gray.clara.net/images/	0 0

GET		newgraphicstemplatenavcommunity2.gif www.gary.gray.clara.net/images/	0 0

GET		newgraphicstemplatenavresource2.gif www.gary.gray.clara.net/images/	0 0

GET		/ www.thezreview.co.uk/ Redirect Chain http://www.thezreview.co.uk/ https://www.thezreview.co.uk/ http://www.thezreview.co.uk/	0 0

GET		favicon.ico www.gary.gray.clara.net/	0 0

GET DATA	200 OK	truncated /	3 KB 0		Image image/png
General Check archive.org Show headers Download Go to Show image Full URL data:truncated Protocol DATA Server -, , ASN (), Reverse DNS Software / Resource Hash `04d05978fdb111358073ab0524e5c1fafc0826615c206987618416b8bd8a4747` Request headers Referer User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Content-Type image/png
GET DATA	200 OK	truncated /	5 KB 0		Image image/png
General Check archive.org Show headers Download Go to Show image Full URL data:truncated Protocol DATA Server -, , ASN (), Reverse DNS Software / Resource Hash `e4222715b556e7d99622c83e620d2f8e090047e56adb07923047f95828d561f2` Request headers Referer User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Content-Type image/png
GET DATA	200 OK	truncated /	155 B 0		Image image/png
General Check archive.org Show headers Download Go to Show image Full URL data:truncated Protocol DATA Server -, , ASN (), Reverse DNS Software / Resource Hash `7808605ddd1f0eaa454aa444293d2f0260943e51e53838fca46506e6a69fe521` Request headers Referer User-Agent Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/126.0.0.0 Safari/537.36 Response headers Content-Type image/png
GET		/ www.thezreview.co.uk/	0 0

Failed requests

These URLs were requested, but there was no response received. You will also see them in the list above.

Domain: www.popuptraffic.com
URL: http://www.popuptraffic.com/assign.php?l=tallguy&mode=behind

Domain: www.popuptraffic.com
URL: http://www.popuptraffic.com/assign.php?l=tallguy

Domain: images.allposters.com
URL: http://images.allposters.com/images/118/039_oceans11_red_double_sided_a.jpg

Domain: www.gary.gray.clara.net
URL: http://www.gary.gray.clara.net/images/newgraphicstemplatenavhome2.gif

Domain: www.gary.gray.clara.net
URL: http://www.gary.gray.clara.net/images/newgraphicstemplatenavnews2.gif

Domain: www.gary.gray.clara.net
URL: http://www.gary.gray.clara.net/images/newgraphicstemplatenavcomingsoon2.gif

Domain: www.gary.gray.clara.net
URL: http://www.gary.gray.clara.net/images/newgraphicstemplatenavreviews2.gif

Domain: www.gary.gray.clara.net
URL: http://www.gary.gray.clara.net/images/newgraphicstemplatenavtrailers2.gif

Domain: www.gary.gray.clara.net
URL: http://www.gary.gray.clara.net/images/newgraphicstemplatenavdvd2.gif

Domain: www.gary.gray.clara.net
URL: http://www.gary.gray.clara.net/images/newgraphicstemplatenavfeatures2.gif

Domain: www.gary.gray.clara.net
URL: http://www.gary.gray.clara.net/images/newgraphicstemplatenavcommunity2.gif

Domain: www.gary.gray.clara.net
URL: http://www.gary.gray.clara.net/images/newgraphicstemplatenavresource2.gif

Domain: www.thezreview.co.uk
URL: http://www.thezreview.co.uk/

Domain: www.gary.gray.clara.net
URL: http://www.gary.gray.clara.net/favicon.ico

Domain: www.thezreview.co.uk
URL: http://www.thezreview.co.uk/

Verdicts & Comments Add Verdict or Comment

49 JavaScript Global Variables

These are the non-standard "global" variables defined on the window object. These can be helpful in identifying possible client-side frameworks and code.

3 Cookies

Cookies are little pieces of information stored in the browser of a user. Whenever a user visits the site again, he will also send his cookie values, thus allowing the website to re-identify him even if he changed locations. This is how permanent logins work.

Domain/Path	Expires	Name / Value
www.gary.gray.clara.net//reviews/	1969-12-31 23:59:59	Name: mc Value: y
www.gary.gray.clara.net/	1969-12-31 23:59:59	Name: h2 Value: o
www.gary.gray.clara.net/	1970-01-20 22:13:38	Name: he Value: llo

3 Console Messages

A page may trigger messages to the console to be logged. These are often error messages about being unable to load a resource or execute a piece of JavaScript. Sometimes they also provide insight into the technology behind a website.

Source	Level	URL Text
javascript	warning	URL: http://www.gary.gray.clara.net//reviews//battleroyale.htm(Line 37) Message: A parser-blocking, cross site (i.e. different eTLD+1) script, http://media.fastclick.net/w/pop.cgi?sid=1984&m=2&v=1.7e&u=http%3A//www.gary.gray.clara.net//reviews//battleroyale.htm&c=11, is invoked via document.write. The network request for this script MAY be blocked by the browser in this or a future page load due to poor network connectivity. If blocked in this page load, it will be confirmed in a subsequent console message. See https://www.chromestatus.com/feature/5718547946799104 for more details.
network	error	URL: http://media.fastclick.net/w/pop.cgi?sid=1984&m=2&v=1.7e&u=http%3A//www.gary.gray.clara.net//reviews//battleroyale.htm&c=11 Message: Failed to load resource: the server responded with a status of 404 (Not Found)
network	error	URL: http://images.allposters.com/images/118/039_oceans11_red_double_sided_a.jpg Message: Failed to load resource: net::ERR_NAME_NOT_RESOLVED

Indicators

This is a term in the security industry to describe indicators such as IPs, Domains, Hashes, etc. This does not imply that any of these indicate malicious activity.

images.allposters.com
media.fastclick.net
www.addfreestats.com
www.afsanalytics.com
www.gary.gray.clara.net
www.popuptraffic.com
www.thezreview.co.uk
images.allposters.com
www.gary.gray.clara.net
www.popuptraffic.com
www.thezreview.co.uk
195.8.66.21
198.50.213.200
2a02:fa8:8806:12::1460
2a02:fa8:8806:20::2100
04d05978fdb111358073ab0524e5c1fafc0826615c206987618416b8bd8a4747
06a4967ad32b4a2e88d2fe49d12f81ad667eddf2a788f9ca1a56faf9b2bc87c9
0fb66f3d6d9274c25f3b4dcc213da715f9d1016ad96d4df8a4d743e9a9f64fd4
1b135e23647d04c48e65f2cb86e2cef9772e9b645207b4efc6c1653f1ae5e737
1b74c67700ab6b82142187a712d151cb5d9b7eb7a43c4591f2bd0a09ab725a64
29d316a4b401896369574886a5a01e2fab3bfbdf5fd55f90b7e643ac75b71b36
4ba70fe515cbc8fd52779fc56786baf47c1c64891454ff67b81395909577db0c
50e21e6d8f27f19cc64a443fc4cf38de749fc03695172a707125fec085a74880
5dfc91d1ec7acb15b92a444093b062234b8174c29238fa315778c4ecc3df673c
616d8319bb0ae629a743e1d595debc91f738fc7125b40a92b5b31e10eec6d6fd
6ca4b5d8d49dea00cb9ff052328a16949b1cdc179e9e5710a935edf1e305d13c
7808605ddd1f0eaa454aa444293d2f0260943e51e53838fca46506e6a69fe521
7907c70246d6d76d9dff9c824f4908a7da5749825fe15c8342a3bb3c44276057
7dfbfc815cf9b1ca5c22848c80444aefee62c9baa9ba1d4cbe8c8200c8a49294
a9e4c87f9572043819998f9f3081e80ed956c71a537960920d49514bfa39e6d1
d7a6becc3e77680b2cab64738ae22dd6b7bdcaa75f30cd0f18a0287df2324aa6
e4222715b556e7d99622c83e620d2f8e090047e56adb07923047f95828d561f2
eb9fab55222f5c0487709774870df886d480f2826a236fc49a83889e58de1adb
f56823814ae441d99f6e8d7c6bd60523a2148f681466bfa907c542de4ebde7a3
fd912a8f61a5b1418fc195f950efbf830184b8a3499e3bd20d58782870660990

www.gary.gray.clara.net Open in urlscan Pro 195.8.66.21 Public Scan

Summary

urlscan.io Verdict: No classification

Domain & IP information

Screenshot Live screenshot Full Image

Page Title

Page URL History Show full URLs

Page Statistics

35 Requests

0 %HTTPS

50 %IPv6

7 Domains

7 Subdomains

5 IPs

3 Countries

43 kBTransfer

64 kBSize

3 Cookies

0 Outgoing links

Page URL History

Redirected requests

35 HTTP transactions Everything HTML Script AJAX CSS Image Expand all 3 data transactions

Request headers

Response headers

Redirect headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Redirect headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Failed requests

Verdicts & Comments Add Verdict or Comment

49 JavaScript Global Variables

3 Cookies

3 Console Messages

Indicators

www.gary.gray.clara.net Open in urlscan Pro
195.8.66.21 Public Scan

Screenshot
Live screenshot

Full Image

35
Requests

0 %
HTTPS

50 %
IPv6

7
Domains

7
Subdomains

5
IPs

3
Countries

43 kB
Transfer

64 kB
Size

3
Cookies

35 HTTP transactions
3 data transactions