app.fasttrackdeliveryservice.space
Seen 1 times between November 18th, 2021 and November 18th, 2021.
General Info Open in Search
Domain | fasttrackdeliveryservice.space (The registered domain) |
Direct hits
Summary of pages hosted on this domain
IPs 23.94.191.226 | 1x
Domains app.fasttrackdeliveryservice.space | 1x
Recent scans (1 total) Show all
URL | Age | |||||
---|---|---|---|---|---|---|
app.fasttrackdeliveryservice.space/en/personal-banking.html | 3 years | 130 | 3 | 2 |
No incoming hits
Nothing talked to this domain
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recent screenshots
Screenshots of pages hosted on this domain
Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to
IPs 23.94.191.226 | 1x
Domains app.fasttrackdeliveryservice.space | 1x
Recently observed hostnames on 'app.fasttrackdeliveryservice.space'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
app.fasttrackdeliveryservice.space
| 2021-11-18
www.app.fasttrackdeliveryservice.space
| 2021-11-18
Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.
WHOIS for app.fasttrackdeliveryservice.space
The queried object does not exist: DOMAIN NOT FOUND >>> Last update of WHOIS database: 2024-10-08T13:06:26.0Z <<< For more information on Whois status codes, please visit https://icann.org/epp >>> IMPORTANT INFORMATION ABOUT THE DEPLOYMENT OF RDAP: please visit https://www.centralnicregistry.com/support/rdap <<< The Whois and RDAP services are provided by CentralNic, and contain information pertaining to Internet domain names registered by our our customers. By using this service you are agreeing (1) not to use any information presented here for any purpose other than determining ownership of domain names, (2) not to store or reproduce this data in any way, (3) not to use any high-volume, automated, electronic processes to obtain data from this service. Abuse of this service is monitored and actions in contravention of these terms will result in being permanently blacklisted. All data is (c) CentralNic Ltd (https://www.centralnicregistry.com) Access to the Whois and RDAP services is rate limited. For more information, visit https://registrar-console.centralnicregistry.com/pub/whois_guidance.