davidkwamidesigns.davidafidemenyo.com
NETWORK-SOLUTIONS-HOSTING, US


Not observed on urlscan.io


General Info Open in Search

Geo United States (US) —
Created July 1st, 2013
Domain davidafidemenyo.com (The registered domain)
AS AS19871 - NETWORK-SOLUTIONS-HOSTING, US
Note: An IP might be announced by multiple ASs. This is not shown.
Registrar ARIN
Route 192.185.16.0/21 (Route of ASN)
PTR mitsudell.com(PTR record of primary IP)
IPv4 192.185.23.100 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

No direct hits
Nothing is hosted on this domain

No incoming hits
Nothing talked to this domain

Recently observed hostnames on 'davidkwamidesigns.davidafidemenyo.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

davidkwamidesigns.davidafidemenyo.com | 2019-06-24 www.davidkwamidesigns.davidafidemenyo.com | 2019-06-24

DNS recordsRetrieved via DNS ANY query

A 192.185.23.100 (TTL: 14400)

Registration information

Created July 1st, 2013
Updated July 6th, 2023
Registrar GoDaddy.com, LLC

WHOIS for davidkwamidesigns.davidafidemenyo.com

Domain Name: DAVIDAFIDEMENYO.COM
Registry Domain ID: 1812116284_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: https://www.godaddy.com
Updated Date: 2023-07-06T15:02:33Z
Creation Date: 2013-07-01T05:36:48Z
Registrar Registration Expiration Date: 2024-07-01T05:36:48Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Registrant Street: DomainsByProxy.com
Registrant Street: 100 S. Mill Ave, Suite 1600
Registrant City: Tempe
Registrant State/Province: Arizona
Registrant Postal Code: 85281
Registrant Country: US
Registrant Phone: +1.4806242599
Registrant Phone Ext:
Registrant Fax: 
Registrant Fax Ext:
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=DAVIDAFIDEMENYO.COM
Registry Admin ID: Not Available From Registry
Admin Name: Registration Private
Admin Organization: Domains By Proxy, LLC
Admin Street: DomainsByProxy.com
Admin Street: 100 S. Mill Ave, Suite 1600
Admin City: Tempe
Admin State/Province: Arizona
Admin Postal Code: 85281
Admin Country: US
Admin Phone: +1.4806242599
Admin Phone Ext:
Admin Fax: 
Admin Fax Ext:
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=DAVIDAFIDEMENYO.COM
Registry Tech ID: Not Available From Registry
Tech Name: Registration Private
Tech Organization: Domains By Proxy, LLC
Tech Street: DomainsByProxy.com
Tech Street: 100 S. Mill Ave, Suite 1600
Tech City: Tempe
Tech State/Province: Arizona
Tech Postal Code: 85281
Tech Country: US
Tech Phone: +1.4806242599
Tech Phone Ext:
Tech Fax: 
Tech Fax Ext:
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=DAVIDAFIDEMENYO.COM
Name Server: NS8059.HOSTGATOR.COM
Name Server: NS8060.HOSTGATOR.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2024-07-04T08:36:33Z <<<
For more information on Whois status codes, please visit https://icann.org/epp

TERMS OF USE: The data contained in this registrar's Whois database, while believed by the
registrar to be reliable, is provided "as is" with no guarantee or warranties regarding its
accuracy. This information is provided for the sole purpose of assisting you in obtaining
information about domain name registration records. Any use of this data for any other purpose
is expressly forbidden without the prior written permission of this registrar. By submitting
an inquiry, you agree to these terms and limitations of warranty. In particular, you agree not
to use this data to allow, enable, or otherwise support the dissemination or collection of this
data, in part or in its entirety, for any purpose, such as transmission by e-mail, telephone,
postal mail, facsimile or other means of mass unsolicited, commercial advertising or solicitations
of any kind, including spam. You further agree not to use this data to enable high volume, automated
or robotic electronic processes designed to collect or compile this data for any purpose, including
mining this data for your own personal or commercial purposes. Failure to comply with these terms
may result in termination of access to the Whois database. These terms may be subject to modification
at any time without notice.