diwakarreddytdpmeeting.appvideo.baluliveevents.in
Seen 1 times between June 10th, 2024 and June 10th, 2024.
General Info Open in Search
Created | September 6th, 2018 |
Domain | baluliveevents.in (The registered domain) |
Direct hits
Summary of pages hosted on this domain
IPs 216.219.95.231 | 1x
Domains diwakarreddytdpmeeting.appvideo.baluliveevents.in | 1x
Recent scans (1 total) Show all
URL | Age | |||||
---|---|---|---|---|---|---|
diwakarreddytdpmeeting.appvideo.baluliveevents.in | 4 months | 41 | 12 | 5 |
No incoming hits
Nothing talked to this domain
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recent screenshots
Screenshots of pages hosted on this domain
Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to
IPs 216.219.95.231 | 1x
Domains diwakarreddytdpmeeting.appvideo.baluliveevents.in | 1x
Recently observed hostnames on 'diwakarreddytdpmeeting.appvideo.baluliveevents.in'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
diwakarreddytdpmeeting.appvideo.baluliveevents.in
| 2024-06-09
www.diwakarreddytdpmeeting.appvideo.baluliveevents.in
| 2024-06-09
Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.
WHOIS for diwakarreddytdpmeeting.appvideo.baluliveevents.in
Domain Name: baluliveevents.in Registry Domain ID: D414400000006629474-IN Registrar WHOIS Server: Registrar URL: https://publicdomainregistry.com/ Updated Date: 2024-08-11T14:46:16Z Creation Date: 2018-09-06T13:13:12Z Registry Expiry Date: 2025-09-06T13:13:12Z Registrar: Endurance Digital Domain Technology Private Limited Registrar IANA ID: 801217 Registrar Abuse Contact Email: abuse@publicdomainregistry.com Registrar Abuse Contact Phone: +1.2013775952 Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited Registry Registrant ID: REDACTED FOR PRIVACY Registrant Name: REDACTED FOR PRIVACY Registrant Organization: Cybermedha Solutions Registrant Street: REDACTED FOR PRIVACY Registrant Street: REDACTED FOR PRIVACY Registrant Street: REDACTED FOR PRIVACY Registrant City: REDACTED FOR PRIVACY Registrant State/Province: Telangana Registrant Postal Code: REDACTED FOR PRIVACY Registrant Country: IN Registrant Phone: REDACTED FOR PRIVACY Registrant Phone Ext: REDACTED FOR PRIVACY Registrant Fax: REDACTED FOR PRIVACY Registrant Fax Ext: REDACTED FOR PRIVACY Registrant Email: Please contact the Registrar listed above Registry Admin ID: REDACTED FOR PRIVACY Admin Name: REDACTED FOR PRIVACY Admin Organization: REDACTED FOR PRIVACY Admin Street: REDACTED FOR PRIVACY Admin Street: REDACTED FOR PRIVACY Admin Street: REDACTED FOR PRIVACY Admin City: REDACTED FOR PRIVACY Admin State/Province: REDACTED FOR PRIVACY Admin Postal Code: REDACTED FOR PRIVACY Admin Country: REDACTED FOR PRIVACY Admin Phone: REDACTED FOR PRIVACY Admin Phone Ext: REDACTED FOR PRIVACY Admin Fax: REDACTED FOR PRIVACY Admin Fax Ext: REDACTED FOR PRIVACY Admin Email: Please contact the Registrar listed above Registry Tech ID: REDACTED FOR PRIVACY Tech Name: REDACTED FOR PRIVACY Tech Organization: REDACTED FOR PRIVACY Tech Street: REDACTED FOR PRIVACY Tech Street: REDACTED FOR PRIVACY Tech Street: REDACTED FOR PRIVACY Tech City: REDACTED FOR PRIVACY Tech State/Province: REDACTED FOR PRIVACY Tech Postal Code: REDACTED FOR PRIVACY Tech Country: REDACTED FOR PRIVACY Tech Phone: REDACTED FOR PRIVACY Tech Phone Ext: REDACTED FOR PRIVACY Tech Fax: REDACTED FOR PRIVACY Tech Fax Ext: REDACTED FOR PRIVACY Tech Email: Please contact the Registrar listed above Name Server: dns2.viewliveevents.com Name Server: dns1.viewliveevents.com Name Server: dns3.viewliveevents.com Name Server: dns4.viewliveevents.com Name Server: dns5.viewliveevents.com Name Server: dns6.viewliveevents.com DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2024-10-14T23:10:56Z <<< For more information on Whois status codes, please visit https://icann.org/epp Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only ,and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator or a Registrar, or NIXI except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.