drandalslakshmifertilityclinic.com
E2E-NETWORKS-IN 282, Sector 19, IN


Seen 1 times between July 2nd, 2024 and July 2nd, 2024.


General Info Open in Search

Geo India (IN) —
AS AS132420 - E2E-NETWORKS-IN 282, Sector 19, IN
Note: An IP might be announced by multiple ASs. This is not shown.
Registrar APNIC
Route 164.52.208.0/20 (Route of ASN)
IPv4 164.52.212.163 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

Direct hits
Summary of pages hosted on this domain

IPs 103.173.112.6 | 1x

Domains cms.drandalslakshmifertilityclinic.com | 1x

Recent scans (1 total) Show all

URL Age
cms.drandalslakshmifertilityclinic.com 4 months

No incoming hits
Nothing talked to this domain

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recent screenshots
Screenshots of pages hosted on this domain

Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to

IPs 103.173.112.6 | 1x

Domains cms.drandalslakshmifertilityclinic.com | 1x

Recently observed hostnames on 'drandalslakshmifertilityclinic.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

mail.cmss.drandalslakshmifertilityclinic.com | 2024-07-04 cmss.drandalslakshmifertilityclinic.com | 2024-07-03 www.cmss.drandalslakshmifertilityclinic.com | 2024-07-03 cms.drandalslakshmifertilityclinic.com | 2024-07-02 cpcalendars.drandalslakshmifertilityclinic.com | 2020-06-09 cpcontacts.drandalslakshmifertilityclinic.com | 2020-06-09 autodiscover.drandalslakshmifertilityclinic.com | 2018-10-01 cpanel.drandalslakshmifertilityclinic.com | 2018-10-01 webdisk.drandalslakshmifertilityclinic.com | 2018-10-01 webmail.drandalslakshmifertilityclinic.com | 2018-10-01 drandalslakshmifertilityclinic.com | 2018-06-16 mail.drandalslakshmifertilityclinic.com | 2018-06-16 www.drandalslakshmifertilityclinic.com | 2018-06-16

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.