dussmann.it
OVH, FR


Seen 21 times between October 31st, 2019 and August 14th, 2024.


General Info Open in Search

Geo London, United Kingdom (GB) —
AS AS16276 - OVH, FR
Note: An IP might be announced by multiple ASs. This is not shown.
Registrar RIPENCC
Route 51.89.0.0/16 (Route of ASN)
PTR pfhans.advertite.de(PTR record of primary IP)
IPv4 51.89.2.105 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

Direct hits
Summary of pages hosted on this domain

IPs 176.52.246.63 | 13x 195.231.59.51 | 3x 51.89.2.105 | 2x

Domains www.dussmann.it | 13x onlineprocurement.dussmann.it | 3x it.dussmann.it | 2x

Recent scans (18 total) Show all

URL Age
onlineprocurement.dussmann.it 2 months
onlineprocurement.dussmann.it 2 months
onlineprocurement.dussmann.it 10 months
it.dussmann.it a year
it.dussmann.it a year

Incoming hits
Summary of pages that talked to this domain

ASNs AS16509 | 3x

IPs 3.65.116.134 | 1x 52.57.52.29 | 1x 52.58.88.241 | 1x

Domains dussmannservicehelpdesk.myfreshworks.com | 3x

Countries DE | 3x

Recent scans (3 total) Show all

URL Age
dussmannservicehelpdesk.myfreshworks.com/login?client_id=134315043955409715&r... 3 months
dussmannservicehelpdesk.myfreshworks.com/login?client_id=134315043955409715&r... a year
dussmannservicehelpdesk.myfreshworks.com/login?client_id=134315043955409715&r... 2 years

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recent screenshots
Screenshots of pages hosted on this domain

Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to

IPs 176.52.246.63 | 13x 195.231.59.51 | 3x 51.89.2.105 | 2x

Domains www.dussmann.it | 13x onlineprocurement.dussmann.it | 3x it.dussmann.it | 2x

Recently observed hostnames on 'dussmann.it'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

crcsassuolo.dussmann.it | 2024-02-15 crcsanmarco.dussmann.it | 2024-02-15 crcsalerno.dussmann.it | 2024-02-15 www.crcsalerno.dussmann.it | 2024-02-15 dussmann4bosch.dussmann.it | 2024-01-30 pest-control-gsi.dussmann.it | 2023-07-18 onlineprocurement.dussmann.it | 2023-06-21 en.dussmann.it | 2023-06-20 it.dussmann.it | 2023-06-20 en.test.dussmann.it | 2023-04-17 test.dussmann.it | 2023-03-23 crcmauriziano.dussmann.it | 2023-03-08 servicedesk.dussmann.it | 2022-11-16 crccomunebari.dussmann.it | 2022-04-28 crccagliari.dussmann.it | 2022-04-11 aeroportocaselle.dussmann.it | 2022-03-08 comunemodugno.dussmann.it | 2022-01-17 crcsasa.dussmann.it | 2021-12-13 crc.dussmann.it | 2021-10-19 toolbox.dussmann.it | 2021-09-27 segnalazioni.dussmann.it | 2021-05-21 scuoladiformazione.dussmann.it | 2020-06-05 extranet.dussmann.it | 2019-10-31 support.dussmann.it | 2018-09-02 www.support.dussmann.it | 2018-09-02 www.dussmann.it | 2016-11-18 dussmann.it | 2015-05-17

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

Related screenshots
Screenshots of pages that talked to this domain

DNS recordsRetrieved via DNS ANY query

A 51.89.2.105 (TTL: 600)
MX mxb-007a4301.gslb.pphosted.com (Priority: 5)
MX mxa-007a4301.gslb.pphosted.com (Priority: 5)
NS ns2.register.it
NS ns1.register.it
TXT c8ErZPAfXFApZFDnfkZtQzio3FkWeVinfB/BPM8SU1dGYCs5XAMh3KIui420sSkZoF/p73GErxcUU/cjsUm7Ew==
TXT MS=938153669DA1456F2B0D0EE5D28BB3E6C600337A
TXT gr0fvbl1hfn01n2f6iekldv5t4
TXT s4end8e88v8lknntu9lve17dq4
TXT v=spf2.0/pra mx a ip4:151.13.48.144/28 ip4:213.149.221.96/27 include:sic001.com include:spf.protection.outlook.com include:email.freshdesk.com ~all
TXT v=spf1 mx a ip4:151.13.48.144/28 ip4:213.149.221.96/27 ip4:66.159.233.120 ip4:66.159.234.209 include:spf.protection.outlook.com include:sic001.com include:spf-007a4301.pphosted.com include:email.freshdesk.com ~all
SOA ns1.register.it
hostmaster: hostmaster.register.it / serial: 2024091301 / refresh: 10800 / retry: 3600 / expire: 604800 / minttl: 86400 /