ewirecardsvcchavarapattathanam.perfectlimited.com
Not observed on urlscan.io
General Info Open in Search
Created | December 6th, 2003 |
Domain | perfectlimited.com (The registered domain) |
No direct hits
Nothing is hosted on this domain
No incoming hits
Nothing talked to this domain
Recently observed hostnames on 'ewirecardsvcchavarapattathanam.perfectlimited.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
ewirecardsvcchavarapattathanam.perfectlimited.com
| 2023-04-12
WHOIS for ewirecardsvcchavarapattathanam.perfectlimited.com
Domain Name: PERFECTLIMITED.COM Registry Domain ID: 107796227_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.publicdomainregistry.com Registrar URL: www.publicdomainregistry.com Updated Date: 2024-05-10T14:55:53Z Creation Date: 2003-12-06T08:03:25Z Registrar Registration Expiration Date: 2024-12-06T08:03:01Z Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com Registrar IANA ID: 303 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Not Available From Registry Registrant Name: In-charge Registrant Organization: Perfect Software Web Solutions Registrant Street: 6/1240C, ist floor, mootolikkandy road, calicut Registrant City: Calicut Registrant State/Province: Kerala Registrant Postal Code: 673001 Registrant Country: IN Registrant Phone: +91.4952725504 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: contact@perfectlimited.com Registry Admin ID: Not Available From Registry Admin Name: In-charge Admin Organization: Perfect Software Web Solutions Admin Street: 6/1240C, ist floor, mootolikkandy road, calicut Admin City: Calicut Admin State/Province: Kerala Admin Postal Code: 673001 Admin Country: IN Admin Phone: +91.4952725504 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: contact@perfectlimited.com Registry Tech ID: Not Available From Registry Tech Name: In-charge Tech Organization: Perfect Software Web Solutions Tech Street: 6/1240C, ist floor, mootolikkandy road, calicut Tech City: Calicut Tech State/Province: Kerala Tech Postal Code: 673001 Tech Country: IN Tech Phone: +91.4952725504 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: contact@perfectlimited.com Name Server: ns1.dns-parking.com Name Server: ns2.dns-parking.com DNSSEC: Unsigned Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com Registrar Abuse Contact Phone: +1.2013775952 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2024-06-06T15:32:57Z <<< For more information on Whois status codes, please visit https://icann.org/epp Registration Service Provided By: The data in this whois database is provided to you for information purposes only, that is, to assist you in obtaining information about or related to a domain name registration record. We make this information available "as is", and do not guarantee its accuracy. By submitting a whois query, you agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (1) enable high volume, automated, electronic processes that stress or load this whois database system providing you this information; or (2) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via direct mail, electronic mail, or by telephone. The compilation, repackaging, dissemination or other use of this data is expressly prohibited without prior written consent from us. The Registrar of record is PDR Ltd. d/b/a PublicDomainRegistry.com. We reserve the right to modify these terms at any time. By submitting this query, you agree to abide by these terms.