ewirecardsvcchavarapattathanam.perfectlimited.com


Not observed on urlscan.io


General Info Open in Search

Created December 6th, 2003
Domain perfectlimited.com (The registered domain)

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

No direct hits
Nothing is hosted on this domain

No incoming hits
Nothing talked to this domain

Recently observed hostnames on 'ewirecardsvcchavarapattathanam.perfectlimited.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

ewirecardsvcchavarapattathanam.perfectlimited.com | 2023-04-12

WHOIS for ewirecardsvcchavarapattathanam.perfectlimited.com

Domain Name: PERFECTLIMITED.COM
Registry Domain ID: 107796227_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 2024-05-10T14:55:53Z
Creation Date: 2003-12-06T08:03:25Z
Registrar Registration Expiration Date: 2024-12-06T08:03:01Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: In-charge
Registrant Organization: Perfect Software Web Solutions
Registrant Street: 6/1240C, ist floor, mootolikkandy road, calicut   
Registrant City: Calicut
Registrant State/Province: Kerala
Registrant Postal Code: 673001
Registrant Country: IN
Registrant Phone: +91.4952725504
Registrant Phone Ext: 
Registrant Fax: 
Registrant Fax Ext: 
Registrant Email: contact@perfectlimited.com
Registry Admin ID: Not Available From Registry
Admin Name: In-charge
Admin Organization: Perfect Software Web Solutions
Admin Street: 6/1240C, ist floor, mootolikkandy road, calicut  
Admin City: Calicut
Admin State/Province: Kerala
Admin Postal Code: 673001
Admin Country: IN
Admin Phone: +91.4952725504
Admin Phone Ext: 
Admin Fax: 
Admin Fax Ext: 
Admin Email: contact@perfectlimited.com
Registry Tech ID: Not Available From Registry
Tech Name: In-charge
Tech Organization: Perfect Software Web Solutions
Tech Street: 6/1240C, ist floor, mootolikkandy road, calicut  
Tech City: Calicut
Tech State/Province: Kerala
Tech Postal Code: 673001
Tech Country: IN
Tech Phone: +91.4952725504
Tech Phone Ext: 
Tech Fax: 
Tech Fax Ext: 
Tech Email: contact@perfectlimited.com
Name Server: ns1.dns-parking.com
Name Server: ns2.dns-parking.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
Registrar Abuse Contact Phone: +1.2013775952
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2024-06-06T15:32:57Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Registration Service Provided By: 

The data in this whois database is provided to you for information purposes 
only, that is, to assist you in obtaining information about or related to a 
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree 
that you will use this data only for lawful purposes and that, under no 
circumstances will you use this data to: 
(1) enable high volume, automated, electronic processes that stress or load 
this whois database system providing you this information; or 
(2) allow, enable, or otherwise support the transmission of mass unsolicited, 
commercial advertising or solicitations via direct mail, electronic mail, or 
by telephone. 
The compilation, repackaging, dissemination or other use of this data is 
expressly prohibited without prior written consent from us. The Registrar of 
record is PDR Ltd. d/b/a PublicDomainRegistry.com. 
We reserve the right to modify these terms at any time. 
By submitting this query, you agree to abide by these terms.