holaquetal.tur.br
HVC-AS, US


Seen 51 times between March 19th, 2024 and July 4th, 2024.


General Info Open in Search

Geo Tampa, Florida, United States (US) —
AS AS29802 - HVC-AS, US
Note: An IP might be announced by multiple ASs. This is not shown.
Registrar ARIN
Route 199.193.117.0/24 (Route of ASN)
PTR b9378.cloud-network.biz(PTR record of primary IP)
IPv4 199.193.117.238 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

Incoming hits
Summary of pages that talked to this domain

ASNs AS16509 | 19x AS20940 | 3x AS13335 | 1x AS24940 | 1x

IPs 18.66.128.62 | 1x 195.201.161.139 | 1x 2600:9000:2057:800:7:49a5:5fd3:b641 | 1x 2600:9000:2057:1000:7:49a5:5fd3:b641 | 1x 2600:9000:2057:6000:7:49a5:5fd3:b641 | 1x 2600:9000:2057:6800:7:49a5:5fd3:b641 | 1x 2600:9000:2057:7000:7:49a5:5fd3:b641 | 1x 2600:9000:2057:8600:7:49a5:5fd3:b641 | 1x 2600:9000:2057:ba00:7:49a5:5fd3:b641 | 1x 2600:9000:2057:d000:7:49a5:5fd3:b641 | 1x

Domains www.amazon.com | 22x roozaneh.net | 1x www.teacherspayteachers.com | 1x

Countries US | 20x DE | 4x

Recent scans (24 total) Show all

URL Age
www.amazon.com/ap/signin 4 months
www.amazon.com/ap/signin 4 months
www.amazon.com/ap/signin 4 months
www.amazon.com/ap/signin 4 months
www.amazon.com/ap/signin 4 months

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recent screenshots
Screenshots of pages hosted on this domain

Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to

IPs 31.170.162.140 | 12x 178.128.62.45 | 4x 146.190.174.202 | 1x 162.240.175.185 | 1x

Domains j8nbwwwexn.holaquetal.tur.br | 5x rtrrqpnkg6.holaquetal.tur.br | 3x appsmanagepaymentsreviewsappgetsintl.holaquetal.tur.br | 2x holaquetal.tur.br | 2x un8ngyywsj.holaquetal.tur.br | 2x viewmangespaymentswebsapprecapt.holaquetal.tur.br | 2x webappsamzpaymntyoii.holaquetal.tur.br | 2x appsrecovrysecurepaymentssreneews.holaquetal.tur.br | 1x ebaqtbrhka.holaquetal.tur.br | 1x intlmanagepayrecovmethodsecureffamlzon.holaquetal.tur.br | 1x

Recently observed hostnames on 'holaquetal.tur.br'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

webappsamzpaymntyoii.holaquetal.tur.br | 2024-07-01 websrecovryaccountmangespaymentsapps.holaquetal.tur.br | 2024-06-18 scureappsmanagepaymentswebsreusser.holaquetal.tur.br | 2024-06-18 appsmanagepaymentsreviewsappgetsintl.holaquetal.tur.br | 2024-06-16 webappsintlaccmangespaymentsverifyintl.holaquetal.tur.br | 2024-06-15 webbappsmngpymntrecovamzonserv.holaquetal.tur.br | 2024-06-15 webappsmanagerecoverpymntmethodintlamz.holaquetal.tur.br | 2024-06-13 webappsrecovpymentmngrsecurityintl.holaquetal.tur.br | 2024-06-11 webappspymentrecovmethodintlamzsesmnger.holaquetal.tur.br | 2024-06-11 intlmangepaymentscureappsrcvry.holaquetal.tur.br | 2024-06-11 aptmangespaymentwebsrenewsapps.holaquetal.tur.br | 2024-06-10 websappmangespaymentcrewapps.holaquetal.tur.br | 2024-06-10 mangespaymentrenewswebsintlapps.holaquetal.tur.br | 2024-06-10 websintlappsrecovrypaymentsrenews.holaquetal.tur.br | 2024-06-09 actmangespaymentsrenewsapp.holaquetal.tur.br | 2024-06-09 appsresstpaymentappsrenewaccintl.holaquetal.tur.br | 2024-06-09 intlwebspaymentsmanageapps.holaquetal.tur.br | 2024-06-09 werintlmangespaymentreviewsapps.holaquetal.tur.br | 2024-06-09 intlmanagepayrecovmethodsecureffamlzon.holaquetal.tur.br | 2024-06-09 webappsmngpymntreserviceaptrecove.holaquetal.tur.br | 2024-06-08 accmangesecuresuspenndpaymetnsintl.holaquetal.tur.br | 2024-06-08 intlmngpymntsreviewsappsamsp.holaquetal.tur.br | 2024-06-08 viewmangespaymentswebsapprecapt.holaquetal.tur.br | 2024-06-08 appsrecovrysecurepaymentssreneews.holaquetal.tur.br | 2024-06-07 appsrecoverymangespaymentrenewsac.holaquetal.tur.br | 2024-06-07 appsrecovrymangespaymentsrenews.holaquetal.tur.br | 2024-06-07 securewebappsmangesaccpaymetsrenewintl.holaquetal.tur.br | 2024-06-07 websappmentsmanageacceptsrcvry.holaquetal.tur.br | 2024-06-06 wepsrescoverymanagespaymentapps.holaquetal.tur.br | 2024-06-06 liber.holaquetal.tur.br | 2024-06-01 www.liber.holaquetal.tur.br | 2024-06-01 securewebappsmangesaccpaymetsrenew.holaquetal.tur.br | 2024-05-27 webappsmanegsecurepaymentsintl.holaquetal.tur.br | 2024-05-24 websecurenewaccmangesintlpaymentsverif.holaquetal.tur.br | 2024-05-19 webintlappsecurenewmangesngfopayments.holaquetal.tur.br | 2024-05-17 autodiscover.holaquetal.tur.br | 2024-04-15 cpanel.holaquetal.tur.br | 2024-04-15 cpcalendars.holaquetal.tur.br | 2024-04-15 cpcontacts.holaquetal.tur.br | 2024-04-15 webdisk.holaquetal.tur.br | 2024-04-15 webmail.holaquetal.tur.br | 2024-04-15 creativez-one.aregius.com.holaquetal.tur.br | 2024-01-10 www.creativez-one.aregius.com.holaquetal.tur.br | 2024-01-10 asino.net.holaquetal.tur.br | 2023-12-05 www.asino.net.holaquetal.tur.br | 2023-12-05 ap1.cpsess2601607395www.holaquetal.tur.br | 2023-11-01 www.ap1.cpsess2601607395www.holaquetal.tur.br | 2023-11-01 200.10.364.08.holaquetal.tur.br | 2023-10-31 a0jsx.holaquetal.tur.br | 2023-10-31 www.200.10.364.08.holaquetal.tur.br | 2023-10-31

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

Related screenshots
Screenshots of pages that talked to this domain

WHOIS for holaquetal.tur.br


domain:      holaquetal.tur.br
owner:       Mkf Comunica��o e eventos
owner-c:     MAFPE49
tech-c:      MAFPE49
nserver:     ns1.cloud-network.biz
nsstat:      20241021 AA
nslastaa:    20241021
nserver:     ns2.cloud-network.biz
nsstat:      20241021 AA
nslastaa:    20241021
saci:        yes
created:     20170920 #17487333
changed:     20241005
expires:     20250920
status:      published

nic-hdl-br:  MAFPE49
person:      marcia ferreira pedroso
created:     20100412
changed:     20230929