leaflydispensaryshop.com
AS-HOSTINGER, CY


Seen 3 times between February 20th, 2021 and April 11th, 2023.


General Info Open in Search

Geo Ukraine (UA) —
AS AS47583 - AS-HOSTINGER, CY
Note: An IP might be announced by multiple ASs. This is not shown.
Registrar RIPENCC
Route 92.113.16.0/21 (Route of ASN)
IPv4 92.113.16.60 
IPv6 2a02:4780:44:f4e9:6aaa:3d9d:be5a:4b61

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

Direct hits
Summary of pages hosted on this domain

IPs 199.59.243.223 | 1x

Domains leaflydispensaryshop.com | 1x

Recent scans (1 total) Show all

URL Age
leaflydispensaryshop.com 2 years

Incoming hits
Summary of pages that talked to this domain

ASNs AS12876 | 1x AS34119 | 1x

IPs 82.163.176.120 | 1x 212.129.28.149 | 1x

Domains authenticcounterfeit.net | 1x trailmaria6.werite.net | 1x

Countries FR | 1x GB | 1x

Recent scans (2 total) Show all

URL Age
trailmaria6.werite.net/post/2021/09/09/Facts-About-MAC-8-STRAIN-MRCWTF.XYZ-Re... 3 years
authenticcounterfeit.net 4 years

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recent screenshots
Screenshots of pages hosted on this domain

Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to

IPs 199.59.243.223 | 1x

Domains leaflydispensaryshop.com | 1x

Recently observed hostnames on 'leaflydispensaryshop.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

buychanderlieronline.leaflydispensaryshop.com | 2022-05-02 www.buychanderlieronline.leaflydispensaryshop.com | 2022-05-02 shroomsworldusa.leaflydispensaryshop.com | 2022-05-02 www.shroomsworldusa.leaflydispensaryshop.com | 2022-05-02 leaflybudsdispense.leaflydispensaryshop.com | 2022-05-01 www.leaflybudsdispense.leaflydispensaryshop.com | 2022-05-01 martinjerrygamefarm.leaflydispensaryshop.com | 2022-04-28 www.martinjerrygamefarm.leaflydispensaryshop.com | 2022-04-28 camelswiftcourier.leaflydispensaryshop.com | 2022-04-24 www.camelswiftcourier.leaflydispensaryshop.com | 2022-04-24 leaflymedicalshop.leaflydispensaryshop.com | 2022-04-18 www.leaflymedicalshop.leaflydispensaryshop.com | 2022-04-18 hondasparepartshop.leaflydispensaryshop.com | 2022-04-15 www.hondasparepartshop.leaflydispensaryshop.com | 2022-04-15 leaflymedshop.leaflydispensaryshop.com | 2022-04-09 nadaswiftexpress.leaflydispensaryshop.com | 2022-04-09 www.leaflymedshop.leaflydispensaryshop.com | 2022-04-09 www.nadaswiftexpress.leaflydispensaryshop.com | 2022-04-09 www.icecapzgarden.leaflydispensaryshop.com | 2022-04-07 icecapzgarden.leaflydispensaryshop.com | 2022-04-07 coloradoreptileshome.leaflydispensaryshop.com | 2022-04-07 www.coloradoreptileshome.leaflydispensaryshop.com | 2022-04-07 leaflymedicaldispensary.leaflydispensaryshop.com | 2022-04-07 www.leaflymedicaldispensary.leaflydispensaryshop.com | 2022-04-07 ganjaonlineshop.leaflydispensaryshop.com | 2022-03-22 www.ganjaonlineshop.leaflydispensaryshop.com | 2022-03-22 61nightsaintof666.leaflydispensaryshop.com | 2022-03-16 www.61nightsaintof666.leaflydispensaryshop.com | 2022-03-16 autodiscover.leaflydispensaryshop.com | 2021-06-02 kenpharmacy.leaflydispensaryshop.com | 2021-05-25 www.kenpharmacy.leaflydispensaryshop.com | 2021-05-25 superelectronicshop.leaflydispensaryshop.com | 2021-05-07 www.superelectronicshop.leaflydispensaryshop.com | 2021-05-07 psychedelicscentertoday.leaflydispensaryshop.com | 2021-05-07 www.psychedelicscentertoday.leaflydispensaryshop.com | 2021-05-07 petsonlinesaleshop.leaflydispensaryshop.com | 2021-05-07 www.petsonlinesaleshop.leaflydispensaryshop.com | 2021-05-07 gunbrokersonline.leaflydispensaryshop.com | 2021-05-06 www.gunbrokersonline.leaflydispensaryshop.com | 2021-05-06 greendispensaryshop.leaflydispensaryshop.com | 2021-05-06 www.greendispensaryshop.leaflydispensaryshop.com | 2021-05-06 420caliweedsdispensary.leaflydispensaryshop.com | 2021-05-06 www.420caliweedsdispensary.leaflydispensaryshop.com | 2021-05-06 tripppharmacystore.leaflydispensaryshop.com | 2021-05-04 www.tripppharmacystore.leaflydispensaryshop.com | 2021-05-04 smartselectronicshop.leaflydispensaryshop.com | 2021-05-04 www.smartselectronicshop.leaflydispensaryshop.com | 2021-05-04 segtls.leaflydispensaryshop.com | 2021-05-04 www.segtls.leaflydispensaryshop.com | 2021-05-04 medical420drugshops.leaflydispensaryshop.com | 2021-05-04

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

Related screenshots
Screenshots of pages that talked to this domain

WHOIS for leaflydispensaryshop.com

You have been banned for abuse.