midnightalchemy.co.uk
NETWORK-SOLUTIONS-HOSTING, US


Seen 2 times between July 23rd, 2023 and September 22nd, 2023.


General Info Open in Search

Geo United States (US) —
AS AS19871 - NETWORK-SOLUTIONS-HOSTING, US
Note: An IP might be announced by multiple ASs. This is not shown.
Registrar ARIN
Route 192.185.16.0/21 (Route of ASN)
PTR 192-185-16-57.unifiedlayer.com(PTR record of primary IP)
IPv4 192.185.16.57 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

No direct hits
Nothing is hosted on this domain

Incoming hits
Summary of pages that talked to this domain

ASNs AS19871 | 2x

IPs 192.185.16.57 | 2x

Domains midnightalchemy.wickedspinsradio.org | 2x

Countries US | 2x

Recent scans (2 total) Show all

URL Age
midnightalchemy.wickedspinsradio.org a year
midnightalchemy.wickedspinsradio.org a year

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recently observed hostnames on 'midnightalchemy.co.uk'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

cpcalendars.midnightalchemy.co.uk | 2020-05-12 cpcontacts.midnightalchemy.co.uk | 2020-05-12 webmail.midnightalchemy.co.uk | 2020-05-04 autodiscover.midnightalchemy.co.uk | 2020-04-30 cpanel.midnightalchemy.co.uk | 2020-04-23 midnightalchemy.co.uk | 2020-04-21 mail.midnightalchemy.co.uk | 2020-04-18 webdisk.midnightalchemy.co.uk | 2020-04-18 www.midnightalchemy.co.uk | 2020-04-18

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

Related screenshots
Screenshots of pages that talked to this domain

DNS recordsRetrieved via DNS ANY query

A 192.185.16.57 (TTL: 14400)
MX mail.midnightalchemy.co.uk
NS ns8014.hostgator.com
NS ns8013.hostgator.com
TXT v=spf1 a mx include:websitewelcome.com ~all
SOA ns8013.hostgator.com
hostmaster: root.gator4007.hostgator.com / serial: 2024092301 / refresh: 86400 / retry: 7200 / expire: 3600000 / minttl: 86400 /

WHOIS for midnightalchemy.co.uk

    Domain name:
        midnightalchemy.co.uk

    Data validation:
        Nominet was not able to match the registrant's name and/or address against a 3rd party source on 06-Oct-2024

    Registrar:
        123-Reg Limited t/a 123-reg [Tag = 123-REG]
        URL: https://www.123-reg.co.uk

    Relevant dates:
        Registered on: 21-Mar-2020
        Expiry date:  21-Mar-2025
        Last updated:  07-Jul-2024

    Registration status:
        Registered until expiry date.

    Name servers:
        ns8013.hostgator.com
        ns8014.hostgator.com

    WHOIS lookup made at 15:27:25 12-Nov-2024

-- 
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

    Copyright Nominet UK 1996 - 2024.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.