mikisoft.jp
INTERQ GMO Internet,Inc, JP


Seen 27 times between January 27th, 2020 and August 25th, 2021.


General Info Open in Search

Geo Japan (JP) —
AS AS7506 - INTERQ GMO Internet,Inc, JP
Note: An IP might be announced by multiple ASs. This is not shown.
Registrar APNIC
Route 163.44.176.0/20 (Route of ASN)
PTR v2001.coreserver.jp(PTR record of primary IP)
IPv4 163.44.176.11 
IPv6 2400:8500:1301:162::11:1

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

Direct hits
Summary of pages hosted on this domain

IPs 202.172.28.154 | 20x 163.44.176.11 | 2x

Domains mikisoft.jp | 18x blog.mikisoft.jp | 4x

Recent scans (22 total) Show all

URL Age
blog.mikisoft.jp/vivaldi-tried-using/ 3 years
blog.mikisoft.jp 4 years
blog.mikisoft.jp 4 years
blog.mikisoft.jp 4 years
mikisoft.jp/wp-content/plugins/wpforms-litv/fedexindex.php/ 4 years

Incoming hits
Summary of pages that talked to this domain

ASNs AS36352 | 5x

IPs 23.95.206.186 | 5x

Domains barcanovscat.ru | 5x

Countries US | 5x

Recent scans (5 total) Show all

URL Age
barcanovscat.ru/erfd/?Email=petr.doucek@vse.cz 5 years
barcanovscat.ru/erfd/309k25pnyzevm17gqdwcbusxlt64jr8hfaio/?cmd=login_submit 5 years
barcanovscat.ru/erfd/xu6eb43o89i0yq5wcpvktlrms1j2gdznah7f/?cmd=login_submit 5 years
barcanovscat.ru/erfd/btvrxkf8d96nsymhui41egzp2wq5aclo30j7/?cmd=login_submit 5 years
barcanovscat.ru/erfd/87foct5r3e2mkxbdgl4hinsvwyuj0paq9z16/?cmd=login_submit 5 years

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recent screenshots
Screenshots of pages hosted on this domain

Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to

IPs 202.172.28.154 | 20x 163.44.176.11 | 2x

Domains mikisoft.jp | 18x blog.mikisoft.jp | 4x

Recently observed hostnames on 'mikisoft.jp'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

beta.mikisoft.jp | 2020-10-19 maintenance.mikisoft.jp | 2019-06-11 mail.mikisoft.jp | 2019-06-11 enshiseserveripchecksystem.mikisoft.jp | 2019-05-21 app.mikisoft.jp | 2018-02-04 blog.mikisoft.jp | 2018-02-04 comivel.mikisoft.jp | 2018-02-04 games.mikisoft.jp | 2018-02-04 music.mikisoft.jp | 2018-02-04 photo.mikisoft.jp | 2018-02-04 download.mikisoft.jp | 2017-12-15 tools.mikisoft.jp | 2017-12-15 playinfo.mikisoft.jp | 2017-10-23 www.mikisoft.jp | 2017-10-23 mikisoft.jp | 2017-05-06

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

Related screenshots
Screenshots of pages that talked to this domain

WHOIS for mikisoft.jp

[ JPRS database provides information on network administration. Its use is    ]
[ restricted to network administration purposes. For further information,     ]
[ use 'whois -h whois.jprs.jp help'. To suppress Japanese output, add'/e'     ]
[ at the end of command, e.g. 'whois -h whois.jprs.jp xxx/e'.                 ]
Domain Information:
[Domain Name]                   MIKISOFT.JP

[Registrant]                    mikisoft.jp

[Name Server]                   ns1.value-domain.com
[Name Server]                   ns2.value-domain.com
[Name Server]                   ns3.value-domain.com
[Signing Key]                   

[Created on]                    2017/04/28
[Expires on]                    2025/04/30
[Status]                        Active
[Last Updated]                  2024/05/01 01:05:04 (JST)

Contact Information:
[Name]                          Whois Privacy Protection Service by VALUE-DOMAIN
[Email]                         whoisproxy@value-domain.com
[Web Page]                      https://www.value-domain.com/
[Postal code]                   530-0011
[Postal Address]                 
[Phone]                         06-6241-6585
[Fax]                           06-6374-0121