mikisoft.jp
INTERQ GMO Internet,Inc, JP


Seen 27 times between April 27th, 2024 and April 27th, 2024.


General Info Open in Search

Geo Japan (JP) —
AS AS7506 - INTERQ GMO Internet,Inc, JP
Note: An IP might be announced by multiple ASs. This is not shown.
Registrar APNIC
Route 2400:8500:1000::/36 (Route of ASN)
IPv6 2400:8500:1301:162::11:1

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

Direct hits
Summary of pages hosted on this domain

Recent scans (22 total) Show all

URL Age
blog.mikisoft.jp/vivaldi-tried-using/ 3 years
blog.mikisoft.jp 3 years
blog.mikisoft.jp 3 years
blog.mikisoft.jp 3 years
mikisoft.jp/wp-content/plugins/wpforms-litv/fedexindex.php/ 4 years

Recent screenshots
Screenshots of pages hosted on this domain

Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to

Related screenshots
Screenshots of pages that talked to this domain

Recently observed hostnames on 'mikisoft.jp'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

beta.mikisoft.jp | 2020-10-19 maintenance.mikisoft.jp | 2019-06-11 mail.mikisoft.jp | 2019-06-11 enshiseserveripchecksystem.mikisoft.jp | 2019-05-21 app.mikisoft.jp | 2018-02-04 blog.mikisoft.jp | 2018-02-04 comivel.mikisoft.jp | 2018-02-04 games.mikisoft.jp | 2018-02-04 music.mikisoft.jp | 2018-02-04 photo.mikisoft.jp | 2018-02-04 download.mikisoft.jp | 2017-12-15 tools.mikisoft.jp | 2017-12-15 playinfo.mikisoft.jp | 2017-10-23 www.mikisoft.jp | 2017-10-23 mikisoft.jp | 2017-05-06

WHOIS for mikisoft.jp

[ JPRS database provides information on network administration. Its use is    ]
[ restricted to network administration purposes. For further information,     ]
[ use 'whois -h whois.jprs.jp help'. To suppress Japanese output, add'/e'     ]
[ at the end of command, e.g. 'whois -h whois.jprs.jp xxx/e'.                 ]
Domain Information:
[Domain Name]                   MIKISOFT.JP

[Registrant]                    mikisoft.jp

[Name Server]                   ns1.value-domain.com
[Name Server]                   ns2.value-domain.com
[Name Server]                   ns3.value-domain.com
[Signing Key]                   

[Created on]                    2017/04/28
[Expires on]                    2024/04/30
[Status]                        Active
[Last Updated]                  2023/05/01 01:05:08 (JST)

Contact Information:
[Name]                          Whois Privacy Protection Service by VALUE-DOMAIN
[Email]                         whoisproxy@value-domain.com
[Web Page]                      https://www.value-domain.com/
[Postal code]                   530-0011
[Postal Address]                 
[Phone]                         06-6241-6585
[Fax]                           06-6374-0121