myhealthpaysrewards.inspireandperform.com
AMAZON-02, US
Not observed on urlscan.io
Live Screenshot
Hover to expand
Attention: This is a live snapshot of this website, we do not host or control it!
No direct hits
Nothing is hosted on this domain
No incoming hits
Nothing talked to this domain
DNS recordsRetrieved via DNS ANY query
Registration information
Created |
March 28th, 2018 |
Updated |
April 11th, 2024 |
Registrar |
Amazon Registrar, Inc. |
WHOIS for myhealthpaysrewards.inspireandperform.com
Domain Name: inspireandperform.com
Registry Domain ID: 2244718559_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.registrar.amazon
Registrar URL: https://registrar.amazon.com
Updated Date: 2024-04-11T19:04:12Z
Creation Date: 2018-03-28T14:10:04Z
Registrar Registration Expiration Date: 2025-03-28T14:10:04Z
Registrar: Amazon Registrar, Inc.
Registrar IANA ID: 468
Registrar Abuse Contact Email: abuse@amazonaws.com
Registrar Abuse Contact Phone: +1.2024422253
Domain Status: ok https://icann.org/epp#ok
Registry Registrant ID: Not Available From Registry
Registrant Name: On behalf of inspireandperform.com owner
Registrant Organization: Identity Protection Service
Registrant Street: PO Box 786
Registrant City: Hayes
Registrant State/Province: Middlesex
Registrant Postal Code: UB3 9TR
Registrant Country: GB
Registrant Phone: +44.1483307527
Registrant Phone Ext:
Registrant Fax: +44.1483304031
Registrant Fax Ext:
Registrant Email: d3882f7a-0d3e-4f94-bd79-2fa1a3d48b35@identity-protect.org
Registry Admin ID: Not Available From Registry
Admin Name: On behalf of inspireandperform.com owner
Admin Organization: Identity Protection Service
Admin Street: PO Box 786
Admin City: Hayes
Admin State/Province: Middlesex
Admin Postal Code: UB3 9TR
Admin Country: GB
Admin Phone: +44.1483307527
Admin Phone Ext:
Admin Fax: +44.1483304031
Admin Fax Ext:
Admin Email: d3882f7a-0d3e-4f94-bd79-2fa1a3d48b35@identity-protect.org
Registry Tech ID: Not Available From Registry
Tech Name: On behalf of inspireandperform.com owner
Tech Organization: Identity Protection Service
Tech Street: PO Box 786
Tech City: Hayes
Tech State/Province: Middlesex
Tech Postal Code: UB3 9TR
Tech Country: GB
Tech Phone: +44.1483307527
Tech Phone Ext:
Tech Fax: +44.1483304031
Tech Fax Ext:
Tech Email: d3882f7a-0d3e-4f94-bd79-2fa1a3d48b35@identity-protect.org
Name Server: NS-298.AWSDNS-37.COM
Name Server: NS-1239.AWSDNS-26.ORG
Name Server: NS-868.AWSDNS-44.NET
Name Server: NS-1852.AWSDNS-39.CO.UK
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2024-05-18T00:04:15Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
By submitting a query to the Amazon Registrar, Inc. WHOIS database, you
agree to abide by the following terms. The data in Amazon Registrar, Inc.'s
WHOIS database is provided by Amazon Registrar, Inc. for the sole purpose of
assisting you in obtaining information about domain name accuracy. You agree
to use this data only for lawful purposes and further agree not to use this
data for any unlawful purpose or to: (1) enable, allow, or otherwise support
the transmission by email, telephone, or facsimile of commercial advertising
or unsolicited bulk email, or (2) enable high volume, automated, electronic
processes to collect or compile this data for any purpose, including mining
this data for your own personal or commercial purposes. Amazon Registrar, Inc.
reserves the right to restrict or terminate your access to the data if you fail
to abide by these terms of use. Amazon Registrar, Inc. reserves the right
to modify these terms at any time.
Visit Amazon Registrar, Inc. at https://registrar.amazon.com
Contact information available here:
https://docs.aws.amazon.com/Route53/latest/DeveloperGuide/domain-contact-support.html
© 2020, Amazon.com, Inc., or its affiliates