polaris.servers.prgn.misp.co.uk
GD-EMEA-DC-LD5, DE
Seen 288 times between April 28th, 2024 and April 28th, 2024.
General Info Open in Search
Geo | Leeds, United Kingdom (GB) — |
Domain | misp.co.uk (The registered domain) |
AS | AS20738 - GD-EMEA-DC-LD5, DE
Note: An IP might be announced by multiple ASs. This is not shown. |
Registrar | RIPENCC |
Route | 185.20.50.0/23 (Route of ASN) |
PTR | polaris.servers.prgn.misp.co.uk(PTR record of primary IP) |
IPv4 | 185.20.50.28 |
No direct hits
Nothing is hosted on this domain
Incoming hits
Summary of pages that talked to this domain
Recent scans (288 total) Show all
URL | Age | |||||
---|---|---|---|---|---|---|
sl88es.uk | 4 days | 51 | 4 | 3 | ||
webmail.cosmicsands.org | 8 days | 13 | 2 | 1 | ||
webmail.jayneacklamfamilylaw.pencilandcoffee.com | 9 days | 13 | 2 | 1 | ||
www.stuarthealth.co.uk | 11 days | 27 | 6 | 3 | ||
corporate.mypersonaltrainer.org.uk | 11 days | 108 | 6 | 2 |
Recently observed hostnames on 'polaris.servers.prgn.misp.co.uk'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
polaris.servers.prgn.misp.co.uk
| 2019-10-11
www.polaris.servers.prgn.misp.co.uk
| 2019-10-11
DNS recordsRetrieved via DNS ANY query
A |
185.20.50.28
(TTL: 600)
|
MX |
polaris.servers.prgn.misp.co.uk
|
NS |
ns3.tsohost.co.uk
|
NS |
ns2.tsohost.co.uk
|
NS |
ns1.tsohost.co.uk
|
TXT |
v=spf1 a mx include:secureserver.net ~all
|
SOA |
ns1.tsohost.co.uk
hostmaster: mail.serveremails.misp.co.uk / serial: 2021091002 / refresh: 86400 / retry: 7200 / expire: 3600000 / minttl: 86400 / |
WHOIS for polaris.servers.prgn.misp.co.uk
Domain name: misp.co.uk Data validation: Nominet was able to match the registrant's name and address against a 3rd party data source on 07-Jul-2014 Registrar: Paragon Internet Group Ltd [Tag = PARAGONINTERNET] URL: https://www.tsohost.com Relevant dates: Registered on: 06-May-2004 Expiry date: 06-May-2025 Last updated: 27-May-2022 Registration status: Registered until expiry date. Name servers: ns1.2host.co.uk 185.52.27.27 ns2.2host.co.uk 95.142.155.4 WHOIS lookup made at 08:48:29 28-Apr-2024 -- This WHOIS information is provided for free by Nominet UK the central registry for .uk domain names. This information and the .uk WHOIS are: Copyright Nominet UK 1996 - 2024. You may not access the .uk WHOIS or use any data from it except as permitted by the terms of use available in full at https://www.nominet.uk/whoisterms, which includes restrictions on: (A) use of the data for advertising, or its repackaging, recompilation, redistribution or reuse (B) obscuring, removing or hiding any or all of this notice and (C) exceeding query rate or volume limits. The data is provided on an 'as-is' basis and may lag behind the register. Access may be withdrawn or restricted at any time.