samedaycarpetcleaningfrankston.com.au
AS-HOSTINGER Hostinger International Limited, CY
Seen 1 times between April 11th, 2024 and April 11th, 2024.
General Info Open in Search
Geo | Phoenix, Arizona, United States (US) — |
AS | AS47583 - AS-HOSTINGER Hostinger International Limited, CY
Note: An IP might be announced by multiple ASs. This is not shown. |
Route | 89.116.192.0/24 (Route of ASN) |
IPv4 | 89.116.192.85 |
IPv6 | 2a02:4780:b:1389:0:2bae:39c8:8 |
Direct hits
Summary of pages hosted on this domain
IPs 2a02:4780:b:1389:0:2bae:39c8:8 | 1x
Domains samedaycarpetcleaningfrankston.com.au | 1x
Recent scans (1 total) Show all
URL | Age | |||||
---|---|---|---|---|---|---|
samedaycarpetcleaningfrankston.com.au | 7 months | 109 | 6 | 2 |
No incoming hits
Nothing talked to this domain
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recent screenshots
Screenshots of pages hosted on this domain
Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to
IPs 2a02:4780:b:1389:0:2bae:39c8:8 | 1x
Domains samedaycarpetcleaningfrankston.com.au | 1x
Recently observed hostnames on 'samedaycarpetcleaningfrankston.com.au'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
couch-cleaning.samedaycarpetcleaningfrankston.com.au
| 2024-09-11
samedaycarpetcleaningfrankston.com.au
| 2023-07-14
www.samedaycarpetcleaningfrankston.com.au
| 2023-07-14
Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.
WHOIS for samedaycarpetcleaningfrankston.com.au
Domain Name: samedaycarpetcleaningfrankston.com.au Registry Domain ID: 6071cc2d157344d29498820a0ced551f-AU Registrar WHOIS Server: whois.auda.org.au Registrar URL: https://www.crazydomains.com.au/contact/ Last Modified: 2024-07-07T09:15:04Z Registrar Name: Web Address Registration Pty Ltd Registrar Abuse Contact Email: registry@dreamscapenetworks.com Registrar Abuse Contact Phone: +61.894220890 Reseller Name: Status: serverRenewProhibited https://identitydigital.au/get-au/whois-status-codes#serverRenewProhibited Status Reason: Not Currently Eligible For Renewal Registrant Contact ID: c9990508bd3441a5a08f77e39f9130cd-AU Registrant Contact Name: Mark Gupta Tech Contact ID: 71c75032647d441ab34f93d92ccee327-AU Tech Contact Name: Mark Gupta Name Server: ns1.dns-parking.com Name Server: ns2.dns-parking.com DNSSEC: unsigned Registrant: BULLET & SUPREME'S SHARP CLEAN DOCTOR PTY LTD Registrant ID: ABN 28654856649 Eligibility Type: Company >>> Last update of WHOIS database: 2024-11-17T17:57:37Z <<< Identity Digital Australia Pty Ltd, for itself and on behalf of .au Domain Administration Limited (auDA), makes the WHOIS registration data directory service (WHOIS Service) available solely for the purposes of: (a) querying the availability of a domain name licence; (b) identifying the holder of a domain name licence; and/or (c) contacting the holder of a domain name licence in relation to that domain name and its use. The WHOIS Service must not be used for any other purpose (even if that purpose is lawful), including: (a) aggregating, collecting or compiling information from the WHOIS database, whether for personal or commercial purposes; (b) enabling the sending of unsolicited electronic communications; and / or (c) enabling high volume, automated, electronic processes that send queries or data to the systems of Afilias, any registrar, any domain name licence holder, or auDA. The WHOIS Service is provided for information purposes only. By using the WHOIS Service, you agree to be bound by these terms and conditions. The WHOIS Service is operated in accordance with the auDA WHOIS Policy (available at https://www.auda.org.au/policy/2014-07-whois-policy).