vda4000.is.cc
IS-AS-1, US
Seen 492 times between December 26th, 2022 and September 23rd, 2024.
General Info Open in Search
Geo | United States (US) — |
Domain | is.cc (The registered domain) |
AS | AS19318 - IS-AS-1, US
Note: An IP might be announced by multiple ASs. This is not shown. |
Registrar | ARIN |
Route | 74.50.64.0/19 (Route of ASN) |
PTR | vda4000.is.cc(PTR record of primary IP) |
IPv4 | 74.50.80.84 |
No direct hits
Nothing is hosted on this domain
Incoming hits
Summary of pages that talked to this domain
ASNs AS19318 | 490x AS197540 | 1x AS26666 | 1x
IPs 74.50.80.84 | 489x 216.219.95.231 | 2x 45.132.244.92 | 1x
Domains srinivassatyavani.livevideo.viewliveevents.net | 10x bnikithachitrakumarsaichv.livevideo.fcliveevents.in | 9x nikhilwedssowmya.livevideo.fcliveevents.in | 6x shaikfaisal.livevideo.viewliveevents.net | 6x akshayawedsgangaprasanna.livevideo.viewliveevents.net | 4x anitharajandramakrishna.livevideo.maaevents9.com | 4x likhithawedspushpendrakumar.livevideo.viewliveevents.net | 4x mounikawedsraghuramreddy.livevideo.viewliveevents.net | 4x nikhilreddywedssowmya.livevideo.fcliveevents.in | 4x saicharanwedaveena.livevideo.viewliveevents.net | 4x
Recent scans (492 total) Show all
URL | Age | |||||
---|---|---|---|---|---|---|
afrozkhanwedstahuratarmeem.livevideo.viewliveevents.net | 2 days | 46 | 11 | 3 | ||
afrozkhanwedstahuratarmeem.livevideo.viewliveevents.net | 2 days | 48 | 11 | 4 | ||
rockstaryouthcreativitykabaapwadyal.livevideo.viewliveevents.net | 4 days | 59 | 11 | 3 | ||
nikhilawithkalyan.livevideo.viewliveevents.net | 8 days | 57 | 24 | 4 | ||
nedawedssaif2.livevideo.fcliveevents.in | 16 days | 55 | 11 | 4 |
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recently observed hostnames on 'vda4000.is.cc'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
vda4000.is.cc
| 2022-09-23
Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.