wellfleetenergyandclimateaction.org
WIX_COM, IL


Seen 2 times between March 23rd, 2024 and March 23rd, 2024.


General Info Open in Search

Geo Ashburn, Virginia, United States (US) —
AS AS58182 - WIX_COM, IL
Note: An IP might be announced by multiple ASs. This is not shown.
Registrar RIPENCC
Route 185.230.63.0/24 (Route of ASN)
PTR unalocated.63.wixsite.com(PTR record of primary IP)
IPv4 185.230.63.186  185.230.63.107  185.230.63.171 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

Direct hits
Summary of pages hosted on this domain

IPs 107.180.40.150 | 2x

Domains wellfleetenergyandclimateaction.org | 2x

Recent scans (2 total) Show all

URL Age
wellfleetenergyandclimateaction.org 5 months
wellfleetenergyandclimateaction.org 5 months

No incoming hits
Nothing talked to this domain

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recent screenshots
Screenshots of pages hosted on this domain

Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to

IPs 107.180.40.150 | 2x

Domains wellfleetenergyandclimateaction.org | 2x

Recently observed hostnames on 'wellfleetenergyandclimateaction.org'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

cpanel.wellfleetenergyandclimateaction.org | 2024-03-22 mail.wellfleetenergyandclimateaction.org | 2024-03-22 webdisk.wellfleetenergyandclimateaction.org | 2024-03-22 www.wellfleetenergyandclimateaction.org | 2024-03-22 wellfleetenergyandclimateaction.org | 2023-02-14

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

DNS recordsRetrieved via DNS ANY query

A 185.230.63.186 (TTL: 3600)
A 185.230.63.171 (TTL: 3600)
A 185.230.63.107 (TTL: 3600)
MX wellfleetenergyandclimateaction-org.mail.protection.outlook.com
NS ns11.wixdns.net
NS ns10.wixdns.net
SOA ns10.wixdns.net
hostmaster: support.wix.com / serial: 2024050217 / refresh: 10800 / retry: 3600 / expire: 604800 / minttl: 3600 /

WHOIS for wellfleetenergyandclimateaction.org

Rate limit exceeded. Try again after: 24h0m0s