edgedevicetrackmyfleet.tatateleservices.com
TATA-AS Tata Communications Ltd, IN
Not observed on urlscan.io
General Info Open in Search
Geo | India (IN) — |
Created | December 13th, 1998 |
Domain | tatateleservices.com (The registered domain) |
AS | AS10199 - TATA-AS Tata Communications Ltd, IN
Note: An IP might be announced by multiple ASs. This is not shown. |
Registrar | APNIC |
Route | 59.161.0.0/16 (Route of ASN) |
IPv4 | 59.161.166.120 |
No direct hits
Nothing is hosted on this domain
No incoming hits
Nothing talked to this domain
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recently observed hostnames on 'edgedevicetrackmyfleet.tatateleservices.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
edgedevicetrackmyfleet.tatateleservices.com
| 2018-03-16
Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.
DNS recordsRetrieved via DNS ANY query
A |
59.161.166.120
(TTL: 300)
|
Registration information
Created | December 13th, 1998 |
Updated | December 8th, 2023 |
Registrar | CSC CORPORATE DOMAINS, INC. |
WHOIS for edgedevicetrackmyfleet.tatateleservices.com
Domain Name: tatateleservices.com Registry Domain ID: 3599055_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.corporatedomains.com Registrar URL: www.cscprotectsbrands.com Updated Date: 2023-12-08T01:06:32Z Creation Date: 1998-12-13T00:00:00Z Registrar Registration Expiration Date: 2024-12-12T05:00:00Z Registrar: CSC CORPORATE DOMAINS, INC. Sponsoring Registrar IANA ID: 299 Registrar Abuse Contact Email: domainabuse@cscglobal.com Registrar Abuse Contact Phone: +1.8887802723 Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited Domain Status: serverDeleteProhibited http://www.icann.org/epp#serverDeleteProhibited Domain Status: serverTransferProhibited http://www.icann.org/epp#serverTransferProhibited Domain Status: serverUpdateProhibited http://www.icann.org/epp#serverUpdateProhibited Registry Registrant ID: Registrant Name: Tata Teleservices Limited Registrant Organization: Tata Teleservices Limited Registrant Street: 2A, Old Ishwar Nagar Registrant City: New Delhi Registrant State/Province: DL Registrant Postal Code: 110065 Registrant Country: IN Registrant Phone: +91.1166555692 Registrant Phone Ext: Registrant Fax: +91.1166555692 Registrant Fax Ext: Registrant Email: domain.management@tatatel.co.in Registry Admin ID: Admin Name: Tata Teleservices Limited Admin Organization: Tata Teleservices Limited Admin Street: 2A, Old Ishwar Nagar Admin City: New Delhi Admin State/Province: DL Admin Postal Code: 110065 Admin Country: IN Admin Phone: +91.1166555692 Admin Phone Ext: Admin Fax: +91.1166555692 Admin Fax Ext: Admin Email: domain.management@tatatel.co.in Registry Tech ID: Tech Name: Tata Teleservices Limited Tech Organization: Tata Teleservices Limited Tech Street: 2A, Old Ishwar Nagar Tech City: New Delhi Tech State/Province: DL Tech Postal Code: 110065 Tech Country: IN Tech Phone: +91.1166555692 Tech Phone Ext: Tech Fax: +91.1166555692 Tech Fax Ext: Tech Email: domain.management@tatatel.co.in Name Server: ns-2005.awsdns-58.co.uk Name Server: ns-792.awsdns-35.net Name Server: ns-151.awsdns-18.com Name Server: ns-1149.awsdns-15.org DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2023-12-08T01:06:32Z <<< For more information on Whois status codes, please visit https://icann.org/epp Corporation Service Company(c) (CSC) The Trusted Partner of More than 50% of the 100 Best Global Brands. Contact us to learn more about our enterprise solutions for Global Domain Name Registration and Management, Trademark Research and Watching, Brand, Logo and Auction Monitoring, as well SSL Certificate Services and DNS Hosting. NOTICE: You are not authorized to access or query our WHOIS database through the use of high-volume, automated, electronic processes or for the purpose or purposes of using the data in any manner that violates these terms of use. The Data in the CSC WHOIS database is provided by CSC for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. CSC does not guarantee its accuracy. By submitting a WHOIS query, you agree to abide by the following terms of use: you agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via direct mail, e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to CSC (or its computer systems). CSC reserves the right to terminate your access to the WHOIS database in its sole discretion for any violations by you of these terms of use. CSC reserves the right to modify these terms at any time. Register your domain name at http://www.cscglobal.com