tatateleservices.com
AMAZON-02, US

Seen 210 times between July 12th, 2024 and July 12th, 2024.

---

Direct hits
Summary of pages hosted on this domain

Recent scans (105 total) Show all

	URL	Age	Size		IPs
	cloudphone.tatateleservices.com/login	3 months	2 MB	51	10	4
	cloudphone.tatateleservices.com/login	4 months	2 MB	52	9	3
	tatateleservices.com	10 months		1	1	0
	tatateleservices.com	10 months		1	1	0
	www.tatateleservices.com/know-your-service-manager.	a year	2 KB	1	1	1

Incoming hits
Summary of pages that talked to this domain

Recent scans (105 total) Show all

	URL	Age	Size		IPs
	www.tatatelebusiness.com	6 hours	2 MB	110	31	5
	www.tatatelebusiness.com	7 days	2 MB	111	31	8
	www.tatatelebusiness.com	9 days	1 MB	111	31	8
	www.tatatelebusiness.com	16 days	2 MB	107	31	8
	www.tatatelebusiness.com	a month	2 MB	109	31	8

Recent screenshots
Screenshots of pages hosted on this domain

Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to

Recently observed hostnames on 'tatateleservices.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

api-smartflo.tatateleservices.com | 2024-04-20 operator-panel.tatateleservices.com | 2024-04-20 wifi.tatateleservices.com | 2024-03-26 www.wifi.tatateleservices.com | 2024-03-26 api-cloudphone.tatateleservices.com | 2023-08-04 livecalls.tatateleservices.com | 2023-06-23 mailprotect2.tatateleservices.com | 2023-02-23 mailprotect.tatateleservices.com | 2022-08-19 lbs-assettracking.tatateleservices.com | 2022-02-08 cloudphone.tatateleservices.com | 2022-01-12 acsbc.tatateleservices.com | 2021-12-14 www.acsbc.tatateleservices.com | 2021-12-14 cep.tatateleservices.com | 2021-08-02 mcpe.tatateleservices.com | 2021-07-23 apidocs.tatateleservices.com | 2021-06-18 tfn-iserve2.tatateleservices.com | 2020-06-11 www.tfn-iserve2.tatateleservices.com | 2020-06-11 www.billpay.tatateleservices.com | 2020-04-10 telemarketer.tatateleservices.com | 2020-01-24 lbs-pro.tatateleservices.com | 2019-07-26 lbs-support.tatateleservices.com | 2019-07-26 lbs-cartracking.tatateleservices.com | 2019-06-13 lbs-fleettracking.tatateleservices.com | 2019-06-13 lbs-schoolbustracking.tatateleservices.com | 2019-06-13 lbs-workforcetracking.tatateleservices.com | 2019-06-13 cartracking.tatateleservices.com | 2019-03-17 fleettracking.tatateleservices.com | 2019-03-17 schoolbustracking.tatateleservices.com | 2019-03-17 workforcetracking.tatateleservices.com | 2019-03-17 billpay.tatateleservices.com | 2018-04-12 trackmyfleet.tatateleservices.com | 2018-03-16 edgedevicetrackmyfleet.tatateleservices.com | 2018-03-16 tatateleservices.com | 2015-09-11 www.tatateleservices.com | 2015-09-05 insta-conference.tatateleservices.com | 2013-04-08

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

Related screenshots
Screenshots of pages that talked to this domain

DNS recordsRetrieved via DNS ANY query

A	35.154.115.105 (TTL: 60)
AAAA	2406:da1a:365:7600:7854:acc4:4e77:d8da (TTL: 300)
MX	tatateleservices-com.mail.protection.outlook.com
NS	ns-151.awsdns-18.com
NS	ns-1149.awsdns-15.org
NS	ns-2005.awsdns-58.co.uk
NS	ns-792.awsdns-35.net
TXT	"v=spf1 include:spf.protection.outlook.com -all" , O1SPMCa4nNi3ucqKk9IJHLR9BJP4XWm67Y5JBGbem3M=
SOA	ns-2005.awsdns-58.co.uk hostmaster: awsdns-hostmaster.amazon.com / serial: 1 / refresh: 7200 / retry: 900 / expire: 1209600 / minttl: 86400 /

Registration information

Created	December 13th, 1998
Updated	December 8th, 2023
Registrar	CSC CORPORATE DOMAINS, INC.

WHOIS for tatateleservices.com

Domain Name: tatateleservices.com
Registry Domain ID: 3599055_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.corporatedomains.com
Registrar URL: www.cscprotectsbrands.com
Updated Date: 2023-12-08T01:06:32Z
Creation Date: 1998-12-13T00:00:00Z
Registrar Registration Expiration Date: 2024-12-12T05:00:00Z
Registrar: CSC CORPORATE DOMAINS, INC.
Sponsoring Registrar IANA ID: 299
Registrar Abuse Contact Email: domainabuse@cscglobal.com
Registrar Abuse Contact Phone: +1.8887802723
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: serverDeleteProhibited http://www.icann.org/epp#serverDeleteProhibited
Domain Status: serverTransferProhibited http://www.icann.org/epp#serverTransferProhibited
Domain Status: serverUpdateProhibited http://www.icann.org/epp#serverUpdateProhibited
Registry Registrant ID: 
Registrant Name: Tata Teleservices Limited
Registrant Organization: Tata Teleservices Limited
Registrant Street: 2A, Old Ishwar Nagar
Registrant City: New Delhi
Registrant State/Province: DL
Registrant Postal Code: 110065
Registrant Country: IN
Registrant Phone: +91.1166555692
Registrant Phone Ext: 
Registrant Fax: +91.1166555692
Registrant Fax Ext: 
Registrant Email: domain.management@tatatel.co.in
Registry Admin ID: 
Admin Name: Tata Teleservices Limited
Admin Organization: Tata Teleservices Limited
Admin Street: 2A, Old Ishwar Nagar
Admin City: New Delhi
Admin State/Province: DL
Admin Postal Code: 110065
Admin Country: IN
Admin Phone: +91.1166555692
Admin Phone Ext: 
Admin Fax: +91.1166555692
Admin Fax Ext: 
Admin Email: domain.management@tatatel.co.in
Registry Tech ID: 
Tech Name: Tata Teleservices Limited
Tech Organization: Tata Teleservices Limited
Tech Street: 2A, Old Ishwar Nagar
Tech City: New Delhi
Tech State/Province: DL
Tech Postal Code: 110065
Tech Country: IN
Tech Phone: +91.1166555692
Tech Phone Ext: 
Tech Fax: +91.1166555692
Tech Fax Ext: 
Tech Email: domain.management@tatatel.co.in
Name Server: ns-2005.awsdns-58.co.uk
Name Server: ns-792.awsdns-35.net
Name Server: ns-151.awsdns-18.com
Name Server: ns-1149.awsdns-15.org
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2023-12-08T01:06:32Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Corporation Service Company(c) (CSC)  The Trusted Partner of More than 50% of the 100 Best Global Brands.

Contact us to learn more about our enterprise solutions for Global Domain Name Registration and Management, Trademark Research and Watching, Brand, Logo and Auction Monitoring, as well SSL Certificate Services and DNS Hosting.

NOTICE: You are not authorized to access or query our WHOIS database through the use of high-volume, automated, electronic processes or for the purpose or purposes of using the data in any manner that violates these terms of use. The Data in the CSC WHOIS database is provided by CSC for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. CSC does not guarantee its accuracy. By submitting a WHOIS query, you agree to abide by the following terms of use: you agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via direct mail, e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to CSC (or its computer systems). CSC reserves the right to terminate your access to the WHOIS database in its sole discretion for any violations by you of these terms of use. CSC reserves the right to modify these terms at any time.

Register your domain name at http://www.cscglobal.com